Phoenix dactylifera (date palm): 103701991 Help Entry 103701991         CDS       T03274                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pda  Phoenix dactylifera (date palm) Pathway pda03420   Nucleotide excision repair pda04120   Ubiquitin mediated proteolysis pda04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pda00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103701991    04120 Ubiquitin mediated proteolysis     103701991   09124 Replication and repair    03420 Nucleotide excision repair     103701991  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pda04121]     103701991    03400 DNA repair and recombination proteins [BR:pda03400]     103701991 Enzymes [BR:pda01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103701991 Ubiquitin system [BR:pda04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103701991   Multi subunit type E3    SCF complex     Ring finger protein      103701991    Cul2 complex      103701991    Cul3 complex      103701991    Cul4 complex      103701991    Cul7 complex      103701991    Cul8 complex      103701991    Cul9 complex      103701991 DNA repair and recombination proteins [BR:pda03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103701991     TCR (transcription coupled repair) factors      Cul4-CSA complex       103701991 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF4644 zf-RING_16 Motif Other DBs NCBI-GeneID:  103701991 NCBI-ProteinID:  XP_008782469 UniProt:  A0A8B7BP24 LinkDB All DBs Position 6:1207624..1217764 Genome browser AA seq 119 aa AA seqDB search MASLDTDINMVPIGEGSSGAAGPSSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcatcgttggatacggacatcaacatggttcccatcggcgagggatcgagcggcgcc gccgggccgtcgtcgtcctccaagaagccgaagcgcttcgagatcaagaagtggaacgcc gtcgccctctgggcctgggatatcgtcgtggataactgcgctatttgcaggaaccacatc atggatctctgcatcgagtgccaggcgaatcaagctagcgcgactagcgaggaatgcact gttgcttggggtgtctgcaatcatgcttttcacttccattgcatcagtcggtggctcaag actcgtcaagtttgccccttggacaacagcgagtgggagttccagaagtacggtcactag

DBGET integrated database retrieval system