Phoenix dactylifera (date palm): 103711519 Help Entry 103711519         CDS       T03274                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pda  Phoenix dactylifera (date palm) Pathway pda03420   Nucleotide excision repair pda04120   Ubiquitin mediated proteolysis pda04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pda00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103711519    04120 Ubiquitin mediated proteolysis     103711519   09124 Replication and repair    03420 Nucleotide excision repair     103711519  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pda04121]     103711519    03400 DNA repair and recombination proteins [BR:pda03400]     103711519 Enzymes [BR:pda01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103711519 Ubiquitin system [BR:pda04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103711519   Multi subunit type E3    SCF complex     Ring finger protein      103711519    Cul2 complex      103711519    Cul3 complex      103711519    Cul4 complex      103711519    Cul7 complex      103711519    Cul8 complex      103711519    Cul9 complex      103711519 DNA repair and recombination proteins [BR:pda03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103711519     TCR (transcription coupled repair) factors      Cul4-CSA complex       103711519 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 DUF4644 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  103711519 NCBI-ProteinID:  XP_008795912 UniProt:  A0A8B9B3D8 LinkDB All DBs Position 15:11445223..11454420 Genome browser AA seq 119 aa AA seqDB search MASLDTDINMVPAGEGSSGAAGPSSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgctggacacggacatcaacatggttcctgccggcgagggatcgagcggcgcc gccgggccgtcgtcgtcctccaagaagccgaagcgcttcgagatcaagaagtggaacgcc gtcgccctctgggcctgggatatcgtcgtggataactgcgctatttgcaggaaccacatc atggatctctgcatcgagtgccaggcgaaccaagccagtgcgactagcgaagaatgcacc gttgcttggggtgtctgcaatcatgcttttcacttccactgcatcagtcggtggctcaag actcgtcaagtttgccctttggacaacagtgagtgggagttccagaaatatggccactaa

DBGET integrated database retrieval system