Phoenix dactylifera (date palm): 120113304 Help Entry 120113304         CDS       T03274                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pda  Phoenix dactylifera (date palm) Pathway pda03420   Nucleotide excision repair pda04120   Ubiquitin mediated proteolysis pda04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pda00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120113304    04120 Ubiquitin mediated proteolysis     120113304   09124 Replication and repair    03420 Nucleotide excision repair     120113304  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pda04121]     120113304    03400 DNA repair and recombination proteins [BR:pda03400]     120113304 Enzymes [BR:pda01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120113304 Ubiquitin system [BR:pda04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120113304   Multi subunit type E3    SCF complex     Ring finger protein      120113304    Cul2 complex      120113304    Cul3 complex      120113304    Cul4 complex      120113304    Cul7 complex      120113304    Cul8 complex      120113304    Cul9 complex      120113304 DNA repair and recombination proteins [BR:pda03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120113304     TCR (transcription coupled repair) factors      Cul4-CSA complex       120113304 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 DUF4644 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  120113304 NCBI-ProteinID:  XP_038990339 UniProt:  A0A8B9B3D8 LinkDB All DBs Position 15:complement(10631768..10639881) Genome browser AA seq 119 aa AA seqDB search MASLDTDINMVPAGEGSSGAAGPSSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgctggacacggacatcaacatggttcctgccggcgagggatcgagcggcgcc gccgggccgtcgtcgtcctccaagaagccgaagcgcttcgagatcaagaagtggaacgcc gtcgccctctgggcctgggatatcgtcgtggataactgcgctatttgcaggaaccacatc atggatctctgcatcgagtgccaggcgaaccaagccagtgcgactagcgaagaatgcacc gttgcttggggtgtctgcaatcatgcttttcacttccactgcatcagtcggtggctcaag actcgtcaagtttgccctttggacaacagtgagtgggagttccagaaatatggccactaa

DBGET integrated database retrieval system