KEGG   Pocillopora damicornis (lace coral): 113667682
Entry
113667682         CDS       T05773                                 

Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1-like
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
pdam04140  Autophagy - animal
pdam04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113667682
   04150 mTOR signaling pathway
    113667682
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113667682
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113667682
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113667682
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113667682
Protein kinases [BR:pdam01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   113667682
Membrane trafficking [BR:pdam04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    113667682
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Haspin_kinase APH ABC1 TCAD9 Kdo
Other DBs
NCBI-GeneID: 113667682
NCBI-ProteinID: XP_027039344
LinkDB
Position
Unknown
AA seq 394 aa
LYFTFQDKEKLYFGLSFAKKGELLPYIIKLGSFDLTCTRFYSAEVVSALEHLHGLGIIHR
DLKPENILMDADMHIKITDFGTAKILSDGEVNEKGRNSFVGTAEYVSPELLTDKRAVKSS
DLWALGCIIYQLLSGLPPFRAGNEYQIFKKIIALDYEFPSGFPEVPKSLVQSLLILDPKL
RLGCDEQGGFPSLKSHEFYEGIDWENLPNETPPDLLPYLPSTSTNEEGLRSKFKLSIHDS
DSDEFDDQLLARFGLSDETPRSSGPTNILNLTESEREERLAKQEKESPWHQFVGNNLIIK
TGVVDKRKGLFPRKRTLILTEGPRLYYVDAQAMVLKGEIPWTKDLRPEAKNFNVFFVHTP
KRIYYLEDHTGYAMDWVKKIEEVHRVYFGDTTQL
NT seq 1185 nt   +upstreamnt  +downstreamnt
ctatattttacatttcaagataaagagaagctttattttggtttaagctttgcaaagaaa
ggagaattgttaccctatattattaagctgggctcgtttgacctgacatgtacaagattt
tattctgctgaagttgtgtcagctttggaacatcttcatggattaggaatcattcacagg
gacttgaaaccagaaaatattctcatggacgcagacatgcacataaagatcactgacttt
ggtacagctaagattctaagtgatggtgaagttaacgaaaaagggagaaattcatttgtt
ggaacagcagaatatgtttcacctgagcttttaacagacaaaagagcagttaaaagctct
gacctctgggctttaggttgtattatttatcaacttctatctggactgccgccattcaga
gctggaaatgagtatcagattttcaaaaagattattgcccttgactatgaatttccaagt
ggttttcctgaagttccaaaaagtcttgtccagagtttattgatattagatccaaaattg
aggcttggctgtgatgagcaaggaggatttccttcgttgaaaagtcacgaattttatgaa
ggaatcgattgggagaatttgccaaatgagacaccccctgatttactaccatatctgccg
tcaacaagcacgaacgaagaaggccttcggagcaagttcaagttgagcattcacgatagc
gacagtgacgagtttgatgaccagctgttggcaagatttggcctgtccgatgaaactcca
cggtcaagtggccctacgaacattctcaatcttacggagagcgagagagaggaaagatta
gcgaagcaggagaaagaatcaccttggcaccaatttgtcggaaataatctcattatcaag
accggtgtggtggacaaaagaaagggtctctttcctcgcaaaagaacactgattcttaca
gagggtccgcggctatattacgttgatgcacaggcaatggttctgaagggagagattcca
tggacaaaagatctcagaccagaagctaagaacttcaacgttttcttcgttcatacgcct
aaacgtatttattacttggaggatcacacgggatacgccatggattgggtcaaaaagatc
gaagaagtccatcgcgtttacttcggagatacaacacaactctaa

DBGET integrated database retrieval system