Pocillopora damicornis (lace coral): 113668843 Help Entry 113668843         CDS       T05773                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pdam  Pocillopora damicornis (lace coral) Pathway pdam00510   N-Glycan biosynthesis pdam00513   Various types of N-glycan biosynthesis pdam04141   Protein processing in endoplasmic reticulum Module pdam_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pdam00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     113668843    00513 Various types of N-glycan biosynthesis     113668843  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113668843 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  113668843 NCBI-ProteinID:  XP_027040600 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MEGLSVDQMNRYASPINPAVFPHLTVVLLSIGIFFMAWFFVYEVTSTKYSRDIYKELLVS LVASLFMGFGVLFLLLWVGIYV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggagggattatcggttgaccagatgaaccgatatgccagtccaatcaatcctgcggtc tttccccatctgactgttgttctgctttctattggaatattctttatggcctggttcttt gtctatgaagtcacttccaccaagtacagtagagatatctacaaggaactgctggtctca ttagtggcatctctatttatgggatttggagtgcttttcctgttactctgggttggaatt tatgtatga

DBGET integrated database retrieval system