Pocillopora damicornis (lace coral): 113677930 Help Entry 113677930         CDS       T05773                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pdam  Pocillopora damicornis (lace coral) Pathway pdam03420   Nucleotide excision repair pdam04120   Ubiquitin mediated proteolysis pdam04141   Protein processing in endoplasmic reticulum pdam04310   Wnt signaling pathway pdam04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pdam00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113677930    04120 Ubiquitin mediated proteolysis     113677930   09124 Replication and repair    03420 Nucleotide excision repair     113677930  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     113677930    04350 TGF-beta signaling pathway     113677930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pdam04121]     113677930    03400 DNA repair and recombination proteins [BR:pdam03400]     113677930 Enzymes [BR:pdam01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      113677930 Ubiquitin system [BR:pdam04121]  Ubiquitin ligases (E3)   UBL E3 ligases    113677930   Multi subunit type E3    SCF complex     Ring finger protein      113677930    Cul2 complex      113677930    Cul3 complex      113677930    Cul4 complex      113677930    Cul7 complex      113677930    Cul8 complex      113677930    Cul9 complex      113677930 DNA repair and recombination proteins [BR:pdam03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       113677930     TCR (transcription coupled repair) factors      Cul4-CSA complex       113677930 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  113677930 NCBI-ProteinID:  XP_027050593 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MAESERMEVDSPAVSSTSSGSNKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC QANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGR NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggcggaatccgaaagaatggaagtcgactcccctgcagtttcatcgacatcttcaggt tccaacaagaaaaggttcgaagttaagaagtggaatgccgttgctctttgggcttgggat attgtggttgataactgcgccatctgtagaaatcatataatggatttatgtatagaatgc caagcaaaccaggcttctgcaacaagtgaagagtgcacagttgcatggggtgtttgtaat catgctttccacttccactgcatctctcgctggttaaagactcgtcaagtttgtcctctg gataacagggaatgggaattccaaaagtatggtcgctaa

DBGET integrated database retrieval system