KEGG   Pocillopora damicornis (lace coral): 113677930
Entry
113677930         CDS       T05773                                 

Definition
(RefSeq) RING-box protein 1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam03420  Nucleotide excision repair
pdam04120  Ubiquitin mediated proteolysis
pdam04141  Protein processing in endoplasmic reticulum
pdam04310  Wnt signaling pathway
pdam04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113677930
   04120 Ubiquitin mediated proteolysis
    113677930
  09124 Replication and repair
   03420 Nucleotide excision repair
    113677930
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113677930
   04350 TGF-beta signaling pathway
    113677930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pdam04121]
    113677930
   03400 DNA repair and recombination proteins [BR:pdam03400]
    113677930
Enzymes [BR:pdam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     113677930
Ubiquitin system [BR:pdam04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   113677930
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     113677930
   ECV complex
     113677930
   Cul3 complex
     113677930
   Cul4 complex
     113677930
   Cul7 complex
     113677930
   Cul9 complex
     113677930
DNA repair and recombination proteins [BR:pdam03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      113677930
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      113677930
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3
Other DBs
NCBI-GeneID: 113677930
NCBI-ProteinID: XP_027050593
LinkDB
Position
Unknown
AA seq 112 aa
MAESERMEVDSPAVSSTSSGSNKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC
QANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGR
NT seq 339 nt   +upstreamnt  +downstreamnt
atggcggaatccgaaagaatggaagtcgactcccctgcagtttcatcgacatcttcaggt
tccaacaagaaaaggttcgaagttaagaagtggaatgccgttgctctttgggcttgggat
attgtggttgataactgcgccatctgtagaaatcatataatggatttatgtatagaatgc
caagcaaaccaggcttctgcaacaagtgaagagtgcacagttgcatggggtgtttgtaat
catgctttccacttccactgcatctctcgctggttaaagactcgtcaagtttgtcctctg
gataacagggaatgggaattccaaaagtatggtcgctaa

DBGET integrated database retrieval system