KEGG   Pocillopora damicornis (lace coral): 113684812
Entry
113684812         CDS       T05773                                 

Name
(RefSeq) uncharacterized protein LOC113684812
  KO
K02373  FAS-associated death domain protein
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113684812
SSDB
Motif
Pfam: DED Death
Other DBs
NCBI-GeneID: 113684812
NCBI-ProteinID: XP_027058014
LinkDB
Position
Unknown
AA seq 235 aa
MEGSSVSEYRKFLFSLCEEITEGNLRKLKYLCLDRLTTRELEEINTATNLFKCLEIKQEI
RKDNLNLLEDLLTQIGRYDLVEKLKEFKSRRSFDCGASGSIKFQVDDDMEDVPDAAEPTA
NVAGDKNDPTALASSGSEEIMLRDVSADVFEELGFLLNPSSFKSWKILAGKLGYTLTHVT
NFKLCPMNSTQMLLQDWSHRGDATVLKLYQTLMNIGREDAAQKLKRILFPSRGTL
NT seq 708 nt   +upstreamnt  +downstreamnt
atggaaggtagctcagtttcagagtacagaaaatttcttttctccttgtgtgaagaaata
acggaaggaaacctacgaaagttgaagtatttatgcctcgatcgattaacaacaagagaa
ttggaggagataaacaccgccacgaatttgtttaaatgcctagagataaaacaagagata
agaaaagacaatctaaatttgttggaggatcttcttacgcaaataggtcgctacgattta
gtggagaaactaaaggagttcaagagcaggcgcagctttgattgtggcgcgagtggttcc
attaagtttcaagttgatgatgacatggaagatgttcccgacgctgccgagccaaccgcg
aatgtagctggcgacaaaaatgatcccacagctcttgcttcaagtgggtctgaagaaatc
atgttgagagacgttagcgcagacgtttttgaagaacttggttttttactaaatccttct
tcatttaaaagttggaaaattctggccggtaagcttggctacaccctcacccatgtaaca
aatttcaaattgtgtccaatgaacagcacccaaatgctgcttcaggattggtcccatcgt
ggagatgctacagttctgaagttgtaccagaccctcatgaatataggacgcgaagatgca
gcccagaaactgaagaggattttatttccttctcgtggtacattgtag

DBGET integrated database retrieval system