KEGG   Phyllostomus discolor (pale spear-nosed bat): 114500980
Entry
114500980         CDS       T07739                                 
Name
(RefSeq) thymosin beta-4-like
  KO
K05764  thymosin, beta 4
Organism
pdic  Phyllostomus discolor (pale spear-nosed bat)
Pathway
pdic04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pdic00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114500980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pdic04812]
    114500980
Cytoskeleton proteins [BR:pdic04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     114500980
SSDB
Motif
Pfam: Thymosin WH2
Other DBs
NCBI-GeneID: 114500980
NCBI-ProteinID: XP_035886123
UniProt: A0A7E6E438
LinkDB
Position
6:complement(63279023..63279361)
AA seq 44 aa
MSDKPDMAEIEKFGKLKLKKTEMQVKNPQPSKETIEQEKQAGKL
NT seq 135 nt   +upstreamnt  +downstreamnt
atgtctgataaacccgatatggctgagattgagaaatttggtaagttgaaactgaagaag
acagaaatgcaagtgaaaaatccacagccctccaaagaaacaattgaacaggagaagcaa
gcaggcaaattgtaa

DBGET integrated database retrieval system