KEGG   Prevotella dentalis: Prede_2095
Entry
Prede_2095        CDS       T02403                                 
Name
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
pdt  Prevotella dentalis
Pathway
pdt00061  Fatty acid biosynthesis
pdt00780  Biotin metabolism
pdt01100  Metabolic pathways
pdt01110  Biosynthesis of secondary metabolites
pdt01212  Fatty acid metabolism
pdt01240  Biosynthesis of cofactors
Module
pdt_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pdt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Prede_2095
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Prede_2095
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Prede_2095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pdt01004]
    Prede_2095
Enzymes [BR:pdt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Prede_2095
Lipid biosynthesis proteins [BR:pdt01004]
 Fatty acid synthase
  Component type
   Prede_2095
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: AGB29370
UniProt: F9D603
LinkDB
Position
2:complement(774031..774783)
AA seq 250 aa
MGLLSGKTALVTGAARGIGKAIALKYASEGANVAFTDLVIDEEHGGLQTEREIAALGVKA
KGYASNAADFAQTEEVVKRVKEEFGSVDILVNNAGITKDGLMLRMTEAQWDAVIAVNLKS
AFNFIHACVPVMMRQRGGSIINMASVVGVHGNAGQANYAASKAGLIALAKSVGQEMGPKG
IRANAIAPGFIDTAMTQALPENIRKEWISKIPLRRGGTVDDIASCAVFLASDMSSYISGQ
VIQIDGGMNM
NT seq 753 nt   +upstreamnt  +downstreamnt
atgggattattaagtggtaagacagccctggtgacaggtgctgcacgcggcattggcaag
gccattgccctgaagtatgccagcgaaggcgccaacgtggcgttcaccgacctcgtcatc
gacgaggagcacggcgggctgcagaccgagcgcgagatagccgccctcggcgtgaaagcc
aagggatatgccagcaatgccgccgactttgcacagacggaggaggtggtgaagcgggtc
aaggaggagtttggctcggtggacatcctcgtgaacaacgccggcatcaccaaggacggc
ctgatgctccgcatgaccgaggcccagtgggacgccgtgattgccgtcaacctgaagagt
gcgttcaacttcatccatgcctgtgtgccggtgatgatgcgccagcgcggcggttcgatc
atcaacatggcctccgtggtgggcgtgcatggcaacgccggacaggccaactacgccgct
tccaaggccggcctgattgcgctggccaagagcgtagggcaggagatgggccccaagggc
atccgtgccaacgccatcgccccgggcttcatcgacacggccatgacccaggccctgccc
gagaatatccgcaaggagtggatttccaagatacccctgcgccgtggcggaaccgtcgac
gacattgccagctgcgccgtgttcctggcctccgacatgtcgagctacatcagcggacag
gttattcagatcgacggcggcatgaacatgtaa

DBGET integrated database retrieval system