Prunus dulcis (almond): 117619981 Help Entry 117619981         CDS       T07328                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pdul  Prunus dulcis (almond) Pathway pdul03420   Nucleotide excision repair pdul04120   Ubiquitin mediated proteolysis pdul04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pdul00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117619981    04120 Ubiquitin mediated proteolysis     117619981   09124 Replication and repair    03420 Nucleotide excision repair     117619981  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pdul04121]     117619981    03400 DNA repair and recombination proteins [BR:pdul03400]     117619981 Enzymes [BR:pdul01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      117619981 Ubiquitin system [BR:pdul04121]  Ubiquitin ligases (E3)   UBL E3 ligases    117619981   Multi subunit type E3    SCF complex     Ring finger protein      117619981    Cul2 complex      117619981    Cul3 complex      117619981    Cul4 complex      117619981    Cul7 complex      117619981    Cul8 complex      117619981    Cul9 complex      117619981 DNA repair and recombination proteins [BR:pdul03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       117619981     TCR (transcription coupled repair) factors      Cul4-CSA complex       117619981 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  117619981 NCBI-ProteinID:  XP_034205950 LinkDB All DBs Position 2:16393712..16396317 Genome browser AA seq 116 aa AA seqDB search MATLDSDVPMVPVGEASSSAGSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgacattggattcagatgtgcctatggttccggtaggcgaggcttcaagcagtgca ggttcatcgaccaagaagcccaagcgatttgagatcaagaagtggaatgctgtcgctctc tgggcctgggatattgttgttgataactgtgccatttgcaggaaccatatcatggatctc tgcattgagtgccaagcaaaccaggcaagcgccacaagcgaggagtgtacagttgcttgg ggggtttgcaaccatgcattccacttccactgcataagccgatggctcaagacccgccaa gtgtgtccattagataatagcgagtgggagtttcagaagtatggtcattag

DBGET integrated database retrieval system