Prunus dulcis (almond): 117620760 Help Entry 117620760         CDS       T07328                                  Name (RefSeq) sm-like protein LSM3B   KO K12622   U6 snRNA-associated Sm-like protein LSm3 Organism pdul  Prunus dulcis (almond) Pathway pdul03018   RNA degradation pdul03040   Spliceosome Brite KEGG Orthology (KO) [BR:pdul00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     117620760   09123 Folding, sorting and degradation    03018 RNA degradation     117620760  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pdul03019]     117620760    03041 Spliceosome [BR:pdul03041]     117620760 Messenger RNA biogenesis [BR:pdul03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      117620760   mRNA degradation factors    5'-3' decay     Lsm complex      117620760 Spliceosome [BR:pdul03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     117620760  Complex C   U2 snRNP components     117620760 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM TIG_SUH Glutaredoxin Motif Other DBs NCBI-GeneID:  117620760 NCBI-ProteinID:  XP_034206846 LinkDB All DBs Position 3:complement(13495871..13498696) Genome browser AA seq 97 aa AA seqDB search MASEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEVVTSVE IDDETYEEIVRTKKRTVPFLFVRGDGVILVSPPLRTA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcaagtgaggaagagagtgccgtgaaggagccgttggatctgatacggctcagcctc gacgagcgcatctacgtcaagctccgctccgaccgtgagctccgcggtaaactccatgct tatgatcaacacttgaatatgattcttggtgatgttgaagaagttgttacttctgtagaa attgatgatgaaacttatgaagagattgtccggacgaaaaaacggactgttccctttctc tttgtcagaggagacggggtcatccttgtttcacctcccctaagaacagcttga

DBGET integrated database retrieval system