KEGG   Prunus dulcis (almond): 117636363
Entry
117636363         CDS       T07328                                 
Name
(RefSeq) 7-deoxyloganetin glucosyltransferase-like
  KO
K22706  (R)-mandelonitrile beta-glucosyltransferase [EC:2.4.1.354]
Organism
pdul  Prunus dulcis (almond)
Pathway
pdul00460  Cyanoamino acid metabolism
pdul01100  Metabolic pathways
pdul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pdul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    117636363
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pdul01003]
    117636363
Enzymes [BR:pdul01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.354  (R)-mandelonitrile beta-glucosyltransferase
     117636363
Glycosyltransferases [BR:pdul01003]
 Others
  Hydrophobic molecule
   117636363
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 117636363
NCBI-ProteinID: XP_034226726
LinkDB
Position
1:complement(39043218..39045170)
AA seq 483 aa
MSPVASKEKPHAVFVPFPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHKRMLESQGSHA
LDGLPSFRFETIPDGLPPADADARRNLPLVCDSTSKTCLAPFEALLTKLNSSPDSPPVTC
IVADGVTSFTLDAAEHFGIPEVLFWTTSACGLMGYVQYYRLIEKGLTPFKDAKDFANGYL
DTEIDWIPGMKDVRLKDMPSFIRTTDPNDIMLHYMVSETERSKKASAIILNTFDALEQEV
VDALSTLLPPIYSIGPLQLPYSEIPSEYNDLKAIGSNLWAENTECLNWLDTKEPNSVVYV
NFGSTTVMTNEQLVEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASW
CPQEQVLLHSAIGGFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEI
DGEVKRDYIDGLVRTLMDGEEGKKMRKKALEWKMLAEDATAPKGSSYLALENVVSKVLLS
PRD
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgagtccagttgcctccaaagagaagccacatgcagtttttgtacccttcccagctcag
ggtcacataaaccctatgctgcaattagccaagctcctcaactacaaaggcttccacata
acctttgtgaacacagagttcaaccacaagcgcatgcttgaatcccaaggttcccacgct
ctcgacggcctcccttcgtttcgattcgaaaccattcccgacggcctccctccggctgat
gccgatgccaggcgcaacttgcctttggtgtgcgattccactagtaaaacctgcttggca
cccttcgaggcgcttttgaccaagctcaactcttcacccgattcccctcctgtgacttgt
attgttgctgatggtgtcaccagcttcacccttgatgcagcagagcatttcgggatccca
gaagtgcttttctggacaactagtgcttgtggcttgatgggctacgttcagtattaccgt
ctcattgagaagggcctcactccttttaaagatgccaaggattttgcaaatgggtatttg
gatacagagattgattggatcccaggcatgaaggatgtcagattgaaggacatgcctagc
tttattagaaccacagacccaaacgacatcatgctgcattatatggtgtctgaaacagag
cgatccaaaaaggcttctgctattattttgaacacatttgatgccttggagcaagaagtt
gtggatgccctttccactttgctacctcctatttactccattggaccccttcagctacca
tacagcgagattccatcagaatacaatgatttgaaggcgatcggatcgaacctgtgggca
gagaatacagagtgccttaactggctggacaccaaagagcccaactctgtggtttatgtc
aactttggaagcaccacagtcatgacaaatgagcagctggttgagttttcttggggactt
gcaaatagcaagaagccatttttgtggatcatcaggcctggccttgttgctggagaaacc
gctgtggtgccacctgagtttttggaggagaccaaagagaggggtatgttggcaagttgg
tgccctcaagaacaggttctgctccactcagccattggagggttcttgactcacagtggc
tggaactctaccctcgaggccttgtgcggcggagtgcctctcatctgctggcctttcttt
gcagagcagcaaacaaatgttaggtacagctgcacacagtggggcataggcattgagata
gacggggaagttaaaagagattacattgacggtcttgtgaggacattgatggatggagaa
gagggcaaaaagatgaggaagaaagcccttgaatggaagatgttggcagaggacgccact
gccccaaaagggtcgtcttacttggctctggaaaatgtggttagcaaagtgcttctttcc
ccaagagattag

DBGET integrated database retrieval system