Primulina eburnea: 140818406 Help Entry 140818406         CDS       T11060                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pebu  Primulina eburnea Pathway pebu03420   Nucleotide excision repair pebu04120   Ubiquitin mediated proteolysis pebu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pebu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     140818406    04120 Ubiquitin mediated proteolysis     140818406   09124 Replication and repair    03420 Nucleotide excision repair     140818406  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pebu04121]     140818406    03400 DNA repair and recombination proteins [BR:pebu03400]     140818406 Enzymes [BR:pebu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      140818406 Ubiquitin system [BR:pebu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    140818406   Multi subunit type E3    SCF complex     Ring finger protein      140818406    Cul2 complex      140818406    Cul3 complex      140818406    Cul4 complex      140818406    Cul7 complex      140818406    Cul8 complex      140818406    Cul9 complex      140818406 DNA repair and recombination proteins [BR:pebu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       140818406     TCR (transcription coupled repair) factors      Cul4-CSA complex       140818406 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  140818406 NCBI-ProteinID:  XP_073034443 LinkDB All DBs Position 17:5855059..5857971 Genome browser AA seq 127 aa AA seqDB search MASLDTDVNMIPAGEGSSDAGPSNAAPTSAPSLSAKKAKRFEIKKWNAVALWAWDIVVDN CAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEW EFQKYGH NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgctggacaccgacgtgaatatgatccccgccggagaggggtcttccgatgct gggccttccaacgctgctcccacgtcagcgccgtcgctatccgccaagaaagccaagcga tttgagatcaagaagtggaacgccgtcgctctctgggcttgggatattgtggttgataat tgtgctatttgcaggaatcatattatggatctctgcatcgagtgtcaggctaatcaagct agtgcgaccagtgaggagtgcacggttgcttggggtgtttgcaatcatgccttccatttc cactgcatcagcagatggctcaagactcgccaagtttgccccttggacaatagtgagtgg gagtttcagaagtatggtcactaa

DBGET integrated database retrieval system