Primulina eburnea: 140825833 Help Entry 140825833         CDS       T11060                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pebu  Primulina eburnea Pathway pebu03420   Nucleotide excision repair pebu04120   Ubiquitin mediated proteolysis pebu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pebu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     140825833    04120 Ubiquitin mediated proteolysis     140825833   09124 Replication and repair    03420 Nucleotide excision repair     140825833  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pebu04121]     140825833    03400 DNA repair and recombination proteins [BR:pebu03400]     140825833 Enzymes [BR:pebu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      140825833 Ubiquitin system [BR:pebu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    140825833   Multi subunit type E3    SCF complex     Ring finger protein      140825833    Cul2 complex      140825833    Cul3 complex      140825833    Cul4 complex      140825833    Cul7 complex      140825833    Cul8 complex      140825833    Cul9 complex      140825833 DNA repair and recombination proteins [BR:pebu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       140825833     TCR (transcription coupled repair) factors      Cul4-CSA complex       140825833 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  140825833 NCBI-ProteinID:  XP_073043925 LinkDB All DBs Position 3:complement(6787980..6790412) Genome browser AA seq 127 aa AA seqDB search MASLDTDVNMIPAGEGSSGAGPSNTAPTPVPAQSAKKAKRFEIKKWNAVSLWAWDIVVDN CAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEW EFQKYGH NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgctggacaccgacgtgaatatgatccccgccggagagggatcttctggcgct gggccctccaacacagcccccacgccagtgccggcgcaatccgccaagaaagccaagcga tttgagatcaagaagtggaacgccgtctctctctgggcttgggatatcgtggtcgataac tgcgctatttgcaggaatcatattatggatctctgcattgagtgtcaggctaatcaagct agtgcgaccagtgaggagtgcactgttgcttggggtgtttgcaatcatgccttccatttc cactgcatcagcagatggctcaagactcgccaagtttgccccttggacaatagtgagtgg gagtttcagaagtatggtcactaa

DBGET integrated database retrieval system