Populus euphratica (Euphrates poplar): 105133967 Help Entry 105133967         CDS       T05872                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism peu  Populus euphratica (Euphrates poplar) Pathway peu03420   Nucleotide excision repair peu04120   Ubiquitin mediated proteolysis peu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:peu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105133967    04120 Ubiquitin mediated proteolysis     105133967   09124 Replication and repair    03420 Nucleotide excision repair     105133967  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:peu04121]     105133967    03400 DNA repair and recombination proteins [BR:peu03400]     105133967 Enzymes [BR:peu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105133967 Ubiquitin system [BR:peu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105133967   Multi subunit type E3    SCF complex     Ring finger protein      105133967    Cul2 complex      105133967    Cul3 complex      105133967    Cul4 complex      105133967    Cul7 complex      105133967    Cul8 complex      105133967    Cul9 complex      105133967 DNA repair and recombination proteins [BR:peu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105133967     TCR (transcription coupled repair) factors      Cul4-CSA complex       105133967 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  105133967 NCBI-ProteinID:  XP_011036448 UniProt:  A0AAJ6UVN0 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MDTDVTMVPAGEASSSSSRKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQA NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggacacggacgtgacgatggttccggcaggcgaggcaagctcctcttcctcaaggaaa ccgaagcgattcgaaattaagaagtggaatgctgttgctctttgggcttgggatattgtg gtggataattgcgctatttgtagaaaccatatcatggatctttgcattgagtgccaagca aatcaagctagtgctacaagcgaggagtgcactgttgcctggggtgtgtgcaaccatgcc ttccacttccactgtatcagccgatggctcaaaacccgccaagtgtgccctcttgataat agtgagtgggagtttcagaagtatggccactaa

DBGET integrated database retrieval system