Pantoea eucalypti: EE896_16150 Help Entry EE896_16150       CDS       T06282                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism pey  Pantoea eucalypti Pathway pey00670   One carbon pool by folate pey00790   Folate biosynthesis pey01100   Metabolic pathways pey01240   Biosynthesis of cofactors pey04981   Folate transport and metabolism Module pey_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pey00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     EE896_16150 (folA)    00670 One carbon pool by folate     EE896_16150 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     EE896_16150 (folA) Enzymes [BR:pey01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      EE896_16150 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QGF28270 LinkDB All DBs Position complement(3449447..3449929) Genome browser AA seq 160 aa AA seqDB search MISLIAALAADRIIGMENAMPWDLPADLAWFKRNTLKKPVIMGRLTFESIGRPLPGRLNI VVSSQPGTTEGVTWVTSLDEAIQAAGDAEEIMVIGGGRVYEQMLKRADRLYLTHIDAEVE GDTQFPDYEPDEWQSTFSEFHDADEQNSHSYCFEILDRRR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattagtcttatcgcggcattagcagcagatcgcattattggaatggagaacgccatg ccgtgggacctgcctgcagatctggcgtggttcaaacgcaatacgctgaagaaaccggtc attatgggtcgactgacctttgaatctattggtcgtccgttacctggccggctgaacatc gtggtcagcagtcagccgggcaccacggaaggcgtcacctgggtcacctcactggatgag gcgatacaggcagccggtgatgctgaagagatcatggtgattggcggtggacgcgtctat gagcagatgctgaagcgcgccgatcgtctctatctgacgcacattgatgcagaagttgaa ggtgatacacagttcccggattacgagccggatgagtggcagtctacgttcagcgagttt cacgatgctgacgagcagaactcccacagctactgctttgagatcctcgaccgtcgtcgc tga

DBGET integrated database retrieval system