Pseudocercospora fijiensis: MYCFIDRAFT_88404 Help Entry MYCFIDRAFT_88404  CDS       T03109                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pfj  Pseudocercospora fijiensis Pathway pfj03420   Nucleotide excision repair pfj04111   Cell cycle - yeast pfj04120   Ubiquitin mediated proteolysis pfj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pfj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MYCFIDRAFT_88404    04120 Ubiquitin mediated proteolysis     MYCFIDRAFT_88404   09124 Replication and repair    03420 Nucleotide excision repair     MYCFIDRAFT_88404  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     MYCFIDRAFT_88404  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pfj04121]     MYCFIDRAFT_88404    03400 DNA repair and recombination proteins [BR:pfj03400]     MYCFIDRAFT_88404 Enzymes [BR:pfj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      MYCFIDRAFT_88404 Ubiquitin system [BR:pfj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    MYCFIDRAFT_88404   Multi subunit type E3    SCF complex     Ring finger protein      MYCFIDRAFT_88404    Cul2 complex      MYCFIDRAFT_88404    Cul3 complex      MYCFIDRAFT_88404    Cul4 complex      MYCFIDRAFT_88404    Cul7 complex      MYCFIDRAFT_88404    Cul8 complex      MYCFIDRAFT_88404    Cul9 complex      MYCFIDRAFT_88404 DNA repair and recombination proteins [BR:pfj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       MYCFIDRAFT_88404     TCR (transcription coupled repair) factors      Cul4-CSA complex       MYCFIDRAFT_88404 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  19342698 NCBI-ProteinID:  XP_007927826 JGI:  88404 UniProt:  M2YXN9 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MADVEMTDAAPKVKKAGPSTGDTDGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLC IDCQANQASATSEECTVAWGICNHAFHFHCISRWLKTRQVCPLDNRDWEFQKYGR NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggccgatgtggagatgacggacgctgcaccaaaagtcaagaaggcgggaccaagcaca ggcgatacagatggcaagaagagattcgaagtgaagaagtggaacgcagtcgcgctctgg gcctgggacatcgttgttgacaactgcgccatctgccgcaaccacatcatggacctgtgt atcgactgtcaagcaaatcaagcttctgccacgagcgaggagtgtacggtcgcttggggt atctgcaaccacgccttccacttccactgcatttctcgatggctcaagacacgtcaagta tgcccgcttgacaatcgcgactgggaatttcagaagtacggacgatga

DBGET integrated database retrieval system