Perca flavescens (yellow perch): 114569772 Help Entry 114569772         CDS       T07494                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pflv  Perca flavescens (yellow perch) Pathway pflv03420   Nucleotide excision repair pflv04110   Cell cycle pflv04114   Oocyte meiosis pflv04120   Ubiquitin mediated proteolysis pflv04141   Protein processing in endoplasmic reticulum pflv04310   Wnt signaling pathway pflv04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pflv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114569772 (rbx1)    04120 Ubiquitin mediated proteolysis     114569772 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     114569772 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     114569772 (rbx1)    04350 TGF-beta signaling pathway     114569772 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     114569772 (rbx1)    04114 Oocyte meiosis     114569772 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pflv04121]     114569772 (rbx1)    03400 DNA repair and recombination proteins [BR:pflv03400]     114569772 (rbx1) Enzymes [BR:pflv01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      114569772 (rbx1) Ubiquitin system [BR:pflv04121]  Ubiquitin ligases (E3)   UBL E3 ligases    114569772 (rbx1)   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      114569772 (rbx1)    Cul2 complex      114569772 (rbx1)    Cul3 complex      114569772 (rbx1)    Cul4 complex      114569772 (rbx1)    Cul7 complex      114569772 (rbx1)    Cul8 complex      114569772 (rbx1)    Cul9 complex      114569772 (rbx1) DNA repair and recombination proteins [BR:pflv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       114569772 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       114569772 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  114569772 NCBI-ProteinID:  XP_028455630 LinkDB All DBs Position 15:4932489..4934767 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagctatggatgtagatacgccaagcggcacaaacagtggagctagcaaaaag cgatttgaagttaaaaagtggaatgctgtggcactgtgggcctgggacatcgtggtggat aactgcgctatctgtcggaaccacatcatggatctctgtatagagtgccaggccaaccaa gcttctgcaacctctgaggagtgcactgtagcctggggtgtctgcaaccatgccttccat ttccactgtatttcccgctggctgaaaaccagacaggtgtgccctctggacaacagggag tgggagtttcagaaatacggacactag

DBGET integrated database retrieval system