Poecilia formosa (Amazon molly): 103141294 Help Entry 103141294         CDS       T07984                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor00510   N-Glycan biosynthesis pfor00513   Various types of N-glycan biosynthesis pfor04141   Protein processing in endoplasmic reticulum Module pfor_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pfor00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     103141294 (tmem258)    00513 Various types of N-glycan biosynthesis     103141294 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103141294 (tmem258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  103141294 NCBI-ProteinID:  XP_007556942 Ensembl:  ENSPFOG00000011043 UniProt:  A0A087XZ04 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaactggaggccatgaccaggtacaccagcccggtgaacccagcggtgttcccccat ctcactgtggtcctgctggccatcggaatgttcttcacagcctggttcttcgtttatgaa gtaacatcaacaaaatacacaagagacgtctacaaggagctgcttatctcactggtggct tcactttttatgggctttggtgtgctcttcttactgctgtgggtgggcatctacgtatga

DBGET integrated database retrieval system