Poecilia formosa (Amazon molly): 103153424 Help Entry 103153424         CDS       T07984                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pfor  Poecilia formosa (Amazon molly) Pathway pfor03420   Nucleotide excision repair pfor04110   Cell cycle pfor04114   Oocyte meiosis pfor04120   Ubiquitin mediated proteolysis pfor04141   Protein processing in endoplasmic reticulum pfor04310   Wnt signaling pathway pfor04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pfor00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103153424 (rbx1)    04120 Ubiquitin mediated proteolysis     103153424 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     103153424 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103153424 (rbx1)    04350 TGF-beta signaling pathway     103153424 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103153424 (rbx1)    04114 Oocyte meiosis     103153424 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pfor04121]     103153424 (rbx1)    03400 DNA repair and recombination proteins [BR:pfor03400]     103153424 (rbx1) Enzymes [BR:pfor01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103153424 (rbx1) Ubiquitin system [BR:pfor04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103153424 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      103153424 (rbx1)    Cul2 complex      103153424 (rbx1)    Cul3 complex      103153424 (rbx1)    Cul4 complex      103153424 (rbx1)    Cul7 complex      103153424 (rbx1)    Cul8 complex      103153424 (rbx1)    Cul9 complex      103153424 (rbx1) DNA repair and recombination proteins [BR:pfor03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103153424 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       103153424 (rbx1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  103153424 NCBI-ProteinID:  XP_007574405 Ensembl:  ENSPFOG00000014301 UniProt:  A0A087Y8H3 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagcgatggatgttgacacaccaagcggtactaacagtggagctagcaagaaa cgcttcgaagtcaaaaagtggaacgctgttgcgctgtgggcctgggacatagtggtggat aattgtgccatctgtaggaaccacatcatggatctctgtatagagtgtcaggccaaccag gcgtctgcgacgtcggaagagtgcaccgtagcctggggggtctgcaatcatgcttttcat tttcactgtatttcccgctggctgaaaaccagacaggtgtgtcctctggacaacagagag tgggagttccagaaatacggacactag

DBGET integrated database retrieval system