Polistes fuscatus (common paper wasp): 122523097 Help Entry 122523097         CDS       T07683                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pfuc  Polistes fuscatus (common paper wasp) Pathway pfuc00510   N-Glycan biosynthesis pfuc00513   Various types of N-glycan biosynthesis pfuc04141   Protein processing in endoplasmic reticulum Module pfuc_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pfuc00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     122523097    00513 Various types of N-glycan biosynthesis     122523097  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122523097 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF1361 Pestivirus_E2 DUF7318 Motif Other DBs NCBI-GeneID:  122523097 NCBI-ProteinID:  XP_043500603 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MVEFESMTRYVSPVNPAVFSLLAIVLLGIGIFFTAWFFVYEVTSTKFTRDIFKELLISLV AAIFSGFGVLFLLLCVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtggaatttgagtctatgacgagatacgtctcgccggtaaacccagcagttttttca ttacttgcaatagtattgcttggtattggaatatttttcacggcatggttcttcgtgtac gaagttaccagtaccaaatttactagagatatattcaaagaattgttgatttcattagtg gcagctatattctcgggatttggtgtattattcttacttctatgcgtgggcatatacgta tga

DBGET integrated database retrieval system