Pestalotiopsis fici: PFICI_12609 Help Entry PFICI_12609       CDS       T04924                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pfy  Pestalotiopsis fici Pathway pfy03420   Nucleotide excision repair pfy04111   Cell cycle - yeast pfy04120   Ubiquitin mediated proteolysis pfy04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pfy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     PFICI_12609    04120 Ubiquitin mediated proteolysis     PFICI_12609   09124 Replication and repair    03420 Nucleotide excision repair     PFICI_12609  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     PFICI_12609  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pfy04121]     PFICI_12609    03400 DNA repair and recombination proteins [BR:pfy03400]     PFICI_12609 Enzymes [BR:pfy01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      PFICI_12609 Ubiquitin system [BR:pfy04121]  Ubiquitin ligases (E3)   UBL E3 ligases    PFICI_12609   Multi subunit type E3    SCF complex     Ring finger protein      PFICI_12609    Cul2 complex      PFICI_12609    Cul3 complex      PFICI_12609    Cul4 complex      PFICI_12609    Cul7 complex      PFICI_12609    Cul8 complex      PFICI_12609    Cul9 complex      PFICI_12609 DNA repair and recombination proteins [BR:pfy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       PFICI_12609     TCR (transcription coupled repair) factors      Cul4-CSA complex       PFICI_12609 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 Motif Other DBs NCBI-GeneID:  19277622 NCBI-ProteinID:  XP_007839381 UniProt:  W3WP34 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MADVDMTDAPAEKKKVVKGGDADGKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGICNHAFHFHCISRWLKARQVCPLDNRDWEFQKYGR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggccgacgtcgacatgaccgatgctcccgccgagaagaagaaggtcgtcaagggcggc gatgctgacggcaagggcgagaagaagcgcttcgaggtaaagaagtggaatgccgtcgcg ctttgggcttgggacattgtcgttgacaactgcgccatttgccgaaaccacatcatggac ctttgcatcgagtgtcaggccaaccaggcttctgccacaagcgaggaatgcacagttgct tggggtatctgcaaccatgccttccacttccactgcatttcccgatggctcaaggctcgt caggtttgccccctcgataaccgcgactgggagttccaaaagtatggtcgataa

DBGET integrated database retrieval system