KEGG   Photobacterium gaetbulicola: H744_2c2948
Entry
H744_2c2948       CDS       T03698                                 
Name
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb03030  DNA replication
pgb03410  Base excision repair
pgb03420  Nucleotide excision repair
pgb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pgb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    H744_2c2948
   03410 Base excision repair
    H744_2c2948
   03420 Nucleotide excision repair
    H744_2c2948
   03430 Mismatch repair
    H744_2c2948
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pgb03032]
    H744_2c2948
   03400 DNA repair and recombination proteins [BR:pgb03400]
    H744_2c2948
Enzymes [BR:pgb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     H744_2c2948
DNA replication proteins [BR:pgb03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     H744_2c2948
DNA repair and recombination proteins [BR:pgb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     H744_2c2948
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     H744_2c2948
   MMR (mismatch excision repair)
    DNA ligase
     H744_2c2948
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      H744_2c2948
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 DNA_ligase_ZBD Nlig-Ia PTCB-BRCT DZR_2
Other DBs
NCBI-ProteinID: AJR09599
UniProt: A0A0C5WX41
LinkDB
Position
2:complement(3320724..3322739)
AA seq 671 aa
MSHDIQQQLDELRELLAYHGHRYYVEDNPEIPDVEYDRMMQQLLAIEAENPELVTVDSPS
QRVGGKPLDGFTQITHEIPMLSLDNAFNDDDLHAFEKRMLDRLLSEPSLTYCCEPKLDGL
AVSLMYENGVLTQAATRGDGTTGENITENVRTIRSIPLKLRGEGWPERLEVRGEVFMPKK
GFEALNEKALKKGEKTFANPRNAAAGSLRQLDSKITATRPLSFYAYSVGVVEGIELVPSQ
YDRLVQLKGWGLPMCPEIRRLANMGEVIAYHQEIGNKREALPYEIDGVVIKVDDIAIQQR
LGFVARAPRWAIAYKFPAQEELTTLNNVEFQVGRTGAITPVAKLEPVFVGGVTVSNATLH
NADEIARLGVMVGDTVVIRRAGDVIPQIASVVESRRPADAMPIVFPESCPVCESKVERVE
GEAVARCSGGLFCQAQRKEALKHFVSRKALDVDGCGEKIIEQLVDREMVATPADLFKLSA
GVLTVLERMGPKSAQKLVDSLSASKQTTLPRFLYSLGIREVGEATAANLASHFETLPAIE
SASKEKLIEVQDVGEIVAAHVYNFFREEHNLAVINELIEVGIHWPAIVKRDADVELPLDG
KTVVLTGSLSQLTRSEAKAALQNLGAKVTGSVSKKTDLLVAGEAAGSKLVKAQELGIEVW
DEQALVDFMAR
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgagccacgacattcagcagcagctcgatgagctgcgcgaactacttgcctatcacggt
caccgctattacgtagaagacaacccggaaataccggatgtggaatacgaccggatgatg
cagcagttgctggcgattgaggcggaaaatccagagctagtgacggttgattcaccgagc
cagcgtgttggtggtaagccgcttgacggctttacccagatcacccatgaaatcccaatg
ttgtcactggacaatgccttcaatgacgatgatcttcacgcgtttgaaaagcgaatgctg
gatcgcctgttgtctgagccttcccttacctactgctgtgagccgaagctagatggcctg
gctgtgagtttgatgtatgagaacggggtactgacacaggctgcgacccgcggtgatggc
accacgggtgaaaacattaccgaaaatgttcgcaccatccgctcgataccattgaagctc
cggggtgagggctggcctgagcggttggaagtccgcggcgaagttttcatgccgaaaaaa
ggctttgaggcgctgaatgaaaaagcactcaaaaaaggagagaagacttttgccaatccg
cgtaacgcggcagcgggcagtctgcgtcagttggactctaagatcaccgcaacccgacct
ttgagtttttatgcctattccgtgggcgtggtcgaaggaatcgagctggtcccaagtcag
tatgaccgcctcgtgcagctcaaaggctggggattgccgatgtgtcctgagatccgccgg
cttgccaatatgggtgaagtgattgcttaccatcaggaaatcggcaacaaacgtgaagcg
ctgccttatgaaattgatggcgtagtgatcaaggttgacgatatcgctattcagcagcgg
ctcggctttgttgcccgggccccgcgttgggctatcgcgtataagttcccggcgcaggaa
gagctgacgacacttaacaacgtcgagttccaagtcggccgcaccggtgccatcaccccg
gtggcaaaactggaacctgtgtttgtcggtggggtgacggtaagtaatgccaccctgcac
aatgccgatgaaattgcccgccttggcgtcatggttggagataccgtggtgatccgccgt
gccggtgatgtgatcccgcagattgcttctgtggttgaatctcgccgtccggctgatgcc
atgccgattgtcttcccggaatcttgcccggtgtgtgaatccaaggttgaacgggtcgag
ggtgaagccgttgcccgttgctccggtggccttttctgtcaggcacagcgcaaagaagcc
ttgaagcactttgtctctcgtaaagcgctggatgtggatggctgtggtgaaaagatcatt
gagcagttggtggatcgcgaaatggtggcaaccccggctgatttgttcaagctttcggcc
ggggtattgacggtactggaacgaatggggccgaagtccgcgcaaaaactggtggattcc
ttgtccgcttccaaacagactacgctgccgcgtttcttgtattcactcggcattcgagag
gtgggtgaggcaacagccgctaatttggcctcgcacttcgaaaccttgccagccattgag
tctgcgagtaaagaaaagctgatagaggtacaggacgtaggtgagatcgttgctgcccat
gtctacaatttcttccgggaagagcacaacctggccgtgatcaacgagcttatcgaggtg
ggtattcactggccagcgattgtaaagcgcgatgctgatgttgaattgcctttagatggc
aagacggtggtcttgaccggtagtttgtctcagcttacgcgctcggaggctaaagctgcc
ctgcaaaaccttggtgccaaagtgacgggcagtgtatcgaagaagactgacttgctggtg
gctggggaagctgctgggtcaaaacttgttaaggctcaagagcttggcattgaggtttgg
gatgagcaggcactggtcgatttcatggctcgttaa

DBGET integrated database retrieval system