Pteropus giganteus (Indian flying fox): 120584840 Help Entry 120584840         CDS       T07511                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism pgig  Pteropus giganteus (Indian flying fox) Pathway pgig01523   Antifolate resistance pgig04010   MAPK signaling pathway pgig04014   Ras signaling pathway pgig04024   cAMP signaling pathway pgig04062   Chemokine signaling pathway pgig04064   NF-kappa B signaling pathway pgig04066   HIF-1 signaling pathway pgig04071   Sphingolipid signaling pathway pgig04137   Mitophagy - animal pgig04151   PI3K-Akt signaling pathway pgig04210   Apoptosis pgig04211   Longevity regulating pathway pgig04218   Cellular senescence pgig04380   Osteoclast differentiation pgig04613   Neutrophil extracellular trap formation pgig04620   Toll-like receptor signaling pathway pgig04621   NOD-like receptor signaling pathway pgig04622   RIG-I-like receptor signaling pathway pgig04623   Cytosolic DNA-sensing pathway pgig04625   C-type lectin receptor signaling pathway pgig04657   IL-17 signaling pathway pgig04658   Th1 and Th2 cell differentiation pgig04659   Th17 cell differentiation pgig04660   T cell receptor signaling pathway pgig04662   B cell receptor signaling pathway pgig04668   TNF signaling pathway pgig04722   Neurotrophin signaling pathway pgig04917   Prolactin signaling pathway pgig04920   Adipocytokine signaling pathway pgig04926   Relaxin signaling pathway pgig04931   Insulin resistance pgig04932   Non-alcoholic fatty liver disease pgig04933   AGE-RAGE signaling pathway in diabetic complications pgig04936   Alcoholic liver disease pgig05010   Alzheimer disease pgig05022   Pathways of neurodegeneration - multiple diseases pgig05030   Cocaine addiction pgig05132   Salmonella infection pgig05133   Pertussis pgig05134   Legionellosis pgig05135   Yersinia infection pgig05140   Leishmaniasis pgig05142   Chagas disease pgig05145   Toxoplasmosis pgig05146   Amoebiasis pgig05152   Tuberculosis pgig05160   Hepatitis C pgig05161   Hepatitis B pgig05162   Measles pgig05163   Human cytomegalovirus infection pgig05164   Influenza A pgig05165   Human papillomavirus infection pgig05166   Human T-cell leukemia virus 1 infection pgig05167   Kaposi sarcoma-associated herpesvirus infection pgig05168   Herpes simplex virus 1 infection pgig05169   Epstein-Barr virus infection pgig05170   Human immunodeficiency virus 1 infection pgig05171   Coronavirus disease - COVID-19 pgig05200   Pathways in cancer pgig05202   Transcriptional misregulation in cancer pgig05203   Viral carcinogenesis pgig05207   Chemical carcinogenesis - receptor activation pgig05208   Chemical carcinogenesis - reactive oxygen species pgig05212   Pancreatic cancer pgig05215   Prostate cancer pgig05220   Chronic myeloid leukemia pgig05221   Acute myeloid leukemia pgig05222   Small cell lung cancer pgig05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pgig05321   Inflammatory bowel disease pgig05415   Diabetic cardiomyopathy pgig05417   Lipid and atherosclerosis pgig05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120584840 (RELA)    04014 Ras signaling pathway     120584840 (RELA)    04064 NF-kappa B signaling pathway     120584840 (RELA)    04668 TNF signaling pathway     120584840 (RELA)    04066 HIF-1 signaling pathway     120584840 (RELA)    04071 Sphingolipid signaling pathway     120584840 (RELA)    04024 cAMP signaling pathway     120584840 (RELA)    04151 PI3K-Akt signaling pathway     120584840 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     120584840 (RELA)   09143 Cell growth and death    04210 Apoptosis     120584840 (RELA)    04218 Cellular senescence     120584840 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120584840 (RELA)    04620 Toll-like receptor signaling pathway     120584840 (RELA)    04621 NOD-like receptor signaling pathway     120584840 (RELA)    04622 RIG-I-like receptor signaling pathway     120584840 (RELA)    04623 Cytosolic DNA-sensing pathway     120584840 (RELA)    04625 C-type lectin receptor signaling pathway     120584840 (RELA)    04660 T cell receptor signaling pathway     120584840 (RELA)    04658 Th1 and Th2 cell differentiation     120584840 (RELA)    04659 Th17 cell differentiation     120584840 (RELA)    04657 IL-17 signaling pathway     120584840 (RELA)    04662 B cell receptor signaling pathway     120584840 (RELA)    04062 Chemokine signaling pathway     120584840 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     120584840 (RELA)    04917 Prolactin signaling pathway     120584840 (RELA)    04926 Relaxin signaling pathway     120584840 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     120584840 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     120584840 (RELA)   09149 Aging    04211 Longevity regulating pathway     120584840 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120584840 (RELA)    05202 Transcriptional misregulation in cancer     120584840 (RELA)    05207 Chemical carcinogenesis - receptor activation     120584840 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     120584840 (RELA)    05203 Viral carcinogenesis     120584840 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120584840 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     120584840 (RELA)    05221 Acute myeloid leukemia     120584840 (RELA)    05220 Chronic myeloid leukemia     120584840 (RELA)    05215 Prostate cancer     120584840 (RELA)    05222 Small cell lung cancer     120584840 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120584840 (RELA)    05170 Human immunodeficiency virus 1 infection     120584840 (RELA)    05161 Hepatitis B     120584840 (RELA)    05160 Hepatitis C     120584840 (RELA)    05171 Coronavirus disease - COVID-19     120584840 (RELA)    05164 Influenza A     120584840 (RELA)    05162 Measles     120584840 (RELA)    05168 Herpes simplex virus 1 infection     120584840 (RELA)    05163 Human cytomegalovirus infection     120584840 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     120584840 (RELA)    05169 Epstein-Barr virus infection     120584840 (RELA)    05165 Human papillomavirus infection     120584840 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     120584840 (RELA)    05135 Yersinia infection     120584840 (RELA)    05133 Pertussis     120584840 (RELA)    05134 Legionellosis     120584840 (RELA)    05152 Tuberculosis     120584840 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     120584840 (RELA)    05145 Toxoplasmosis     120584840 (RELA)    05140 Leishmaniasis     120584840 (RELA)    05142 Chagas disease     120584840 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     120584840 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     120584840 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     120584840 (RELA)   09165 Substance dependence    05030 Cocaine addiction     120584840 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120584840 (RELA)    05418 Fluid shear stress and atherosclerosis     120584840 (RELA)    05415 Diabetic cardiomyopathy     120584840 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120584840 (RELA)    04932 Non-alcoholic fatty liver disease     120584840 (RELA)    04931 Insulin resistance     120584840 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     120584840 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     120584840 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pgig03000]     120584840 (RELA) Transcription factors [BR:pgig03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     120584840 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  120584840 NCBI-ProteinID:  XP_039696841 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MDDLFPLIFPSEPAPASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAINQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTGTRLGRGT PAKESEARAGHLGL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgttccccctcatcttcccctctgaaccagccccggcctccggcccctat gtggaaatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt cgctcagcaggcagtatccccggcgagaggagcacggacaccaccaagacccaccccacc atcaagatcaatggctacacgggaccagggacagttcgcatctccttggtcaccaaggac ccccctcaccggcctcacccccatgagctggtggggaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtgaagaagcgggacctggaacaggccatcaatcagcgcatccagaccaacaacaacccc ttccaagttcccatagaagagcagcgtggggactacgacttgaatgctgttcggctctgc ttccaggtgacagtgcgggacccgtcaggcaggcccctccgcctgtcacctgtcctctct catcccatctttgacaaccgcgcccccaacacagcagagctcaagatctgccgagtgaac cgcaactccgggagctgcctcggtggggatgagattttcctgctgtgtgacaaggtgcag aaagaggacattgaggtgtacttcactggacccggctgggaggcccgaggctccttttcg caagccgatgtccatcgacaagtggctattgtgttccggacccctccctatgccgacccc agcttgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaattccagtacttgccagacacaggtacacggctggggaggggaact ccagccaaggagagcgaggccagggctggacatctggggctgtag

DBGET integrated database retrieval system