Pteropus vampyrus (Indian flying fox): 120600654 Help Entry 120600654         CDS       T07511                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig00510   N-Glycan biosynthesis pgig00513   Various types of N-glycan biosynthesis pgig04141   Protein processing in endoplasmic reticulum Module pgig_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pgig00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     120600654 (TMEM258)    00513 Various types of N-glycan biosynthesis     120600654 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120600654 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  120600654 NCBI-ProteinID:  XP_039716058 UniProt:  A0A6P3QMT6 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MPLAQAHFLFRPDSAPAVLTRFSGGGAADYLEPGKMELEAMSRYTSPVNPAVFPHLTVVL LAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgccacttgcgcaggcgcacttccttttccggccggacagcgcgcctgctgtgctgacg cgtttttccggtggcggagcggcggattacctagagccgggcaaaatggagctcgaggcc atgagcagatataccagcccagtgaacccggccgtctttccccatctgaccgtggtgctg ttggccattggcatgttcttcaccgcctggttcttcgtttatgaggtcacctccaccaag tacactcgggacatctacaaagagctcctcatctccttggtggcctcactcttcatgggc tttggagtcctcttcctgctgctctgggttggcatctatgtatga

DBGET integrated database retrieval system