Pteropus vampyrus (Indian flying fox): 120602335 Help Entry 120602335         CDS       T07511                                  Symbol IL6 Name (RefSeq) interleukin-6 isoform X1   KO K05405   interleukin 6 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig01521   EGFR tyrosine kinase inhibitor resistance pgig01523   Antifolate resistance pgig04060   Cytokine-cytokine receptor interaction pgig04061   Viral protein interaction with cytokine and cytokine receptor pgig04066   HIF-1 signaling pathway pgig04068   FoxO signaling pathway pgig04151   PI3K-Akt signaling pathway pgig04218   Cellular senescence pgig04620   Toll-like receptor signaling pathway pgig04621   NOD-like receptor signaling pathway pgig04623   Cytosolic DNA-sensing pathway pgig04625   C-type lectin receptor signaling pathway pgig04630   JAK-STAT signaling pathway pgig04640   Hematopoietic cell lineage pgig04657   IL-17 signaling pathway pgig04659   Th17 cell differentiation pgig04668   TNF signaling pathway pgig04672   Intestinal immune network for IgA production pgig04931   Insulin resistance pgig04932   Non-alcoholic fatty liver disease pgig04933   AGE-RAGE signaling pathway in diabetic complications pgig04936   Alcoholic liver disease pgig05010   Alzheimer disease pgig05020   Prion disease pgig05022   Pathways of neurodegeneration - multiple diseases pgig05132   Salmonella infection pgig05133   Pertussis pgig05134   Legionellosis pgig05135   Yersinia infection pgig05142   Chagas disease pgig05143   African trypanosomiasis pgig05144   Malaria pgig05146   Amoebiasis pgig05152   Tuberculosis pgig05161   Hepatitis B pgig05162   Measles pgig05163   Human cytomegalovirus infection pgig05164   Influenza A pgig05166   Human T-cell leukemia virus 1 infection pgig05167   Kaposi sarcoma-associated herpesvirus infection pgig05168   Herpes simplex virus 1 infection pgig05169   Epstein-Barr virus infection pgig05171   Coronavirus disease - COVID-19 pgig05200   Pathways in cancer pgig05202   Transcriptional misregulation in cancer pgig05321   Inflammatory bowel disease pgig05323   Rheumatoid arthritis pgig05332   Graft-versus-host disease pgig05410   Hypertrophic cardiomyopathy pgig05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120602335 (IL6)    04668 TNF signaling pathway     120602335 (IL6)    04066 HIF-1 signaling pathway     120602335 (IL6)    04068 FoxO signaling pathway     120602335 (IL6)    04151 PI3K-Akt signaling pathway     120602335 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120602335 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     120602335 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120602335 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120602335 (IL6)    04620 Toll-like receptor signaling pathway     120602335 (IL6)    04621 NOD-like receptor signaling pathway     120602335 (IL6)    04623 Cytosolic DNA-sensing pathway     120602335 (IL6)    04625 C-type lectin receptor signaling pathway     120602335 (IL6)    04659 Th17 cell differentiation     120602335 (IL6)    04657 IL-17 signaling pathway     120602335 (IL6)    04672 Intestinal immune network for IgA production     120602335 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120602335 (IL6)    05202 Transcriptional misregulation in cancer     120602335 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120602335 (IL6)    05161 Hepatitis B     120602335 (IL6)    05171 Coronavirus disease - COVID-19     120602335 (IL6)    05164 Influenza A     120602335 (IL6)    05162 Measles     120602335 (IL6)    05168 Herpes simplex virus 1 infection     120602335 (IL6)    05163 Human cytomegalovirus infection     120602335 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     120602335 (IL6)    05169 Epstein-Barr virus infection     120602335 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     120602335 (IL6)    05135 Yersinia infection     120602335 (IL6)    05133 Pertussis     120602335 (IL6)    05134 Legionellosis     120602335 (IL6)    05152 Tuberculosis     120602335 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     120602335 (IL6)    05144 Malaria     120602335 (IL6)    05142 Chagas disease     120602335 (IL6)    05143 African trypanosomiasis     120602335 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     120602335 (IL6)    05321 Inflammatory bowel disease     120602335 (IL6)    05332 Graft-versus-host disease     120602335 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     120602335 (IL6)    05020 Prion disease     120602335 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     120602335 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120602335 (IL6)    05410 Hypertrophic cardiomyopathy     120602335 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120602335 (IL6)    04932 Non-alcoholic fatty liver disease     120602335 (IL6)    04931 Insulin resistance     120602335 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     120602335 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     120602335 (IL6)    01523 Antifolate resistance     120602335 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120602335 (IL6) Cytokines and neuropeptides [BR:pgig04052]  Cytokines   Interleukins    120602335 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 DUF4924 GCSF IL11 IL23 Motif Other DBs NCBI-GeneID:  120602335 NCBI-ProteinID:  XP_039718458 LinkDB All DBs Position Unknown AA seq 242 aa AA seqDB search MLDFFLAACGLESSHTAGGSYEHKLRKMPQGPPLTSHQRGAFRPVAFSLGLLLVMATAFP IPVPSGEDSKDDTNSNRPQLTSPNQTENLIKSIFLEISEVRNKMCGNDDSCKNSKEVLTE NNLNLPKMAEKDGCFQSGFNQETCLMKITTGLLEFQIYLDYLQNKFEENAKAMQMRTKAL VQVLKQKVKNPNEITTPDPTTNSSLLAKLQSQSEWLQTTTIHLILRSLEDFLQFTQRAVR IM NT seq 729 nt NT seq  +upstreamnt  +downstreamnt atgctagatttcttcctagccgcctgtggactcgaatcaagtcatacagcaggggggagc tatgaacacaagctccggaaaatgccacaaggtcctcctttgacatcccatcaaagaggc gctttcaggccagtcgccttctccctggggctgctgctagtgatggctactgctttccct attccggttccctccggagaagattccaaagatgataccaactcaaacagaccacaactc acctctccaaaccaaaccgaaaacctcattaagtccatcttccttgaaatctctgaagtg agaaataagatgtgtggcaacgatgactcatgtaaaaacagcaaggaggtactgacagaa aacaacctgaaccttccaaaaatggcagaaaaagatggatgcttccagtcggggttcaat caggagacctgcttgatgaaaatcactaccggtctcctggagtttcagatatacctggac tacctccagaacaagtttgaggaaaacgccaaggcgatgcagatgcgaaccaaagccctg gtccaggtgctgaagcagaaggtaaagaatccaaatgagataaccacccctgacccaacc acaaactccagcctgctggctaagctgcagtcgcagagcgaatggctgcagaccacgaca attcacctcatcctgcgaagccttgaggatttcctgcagttcacccagagggctgtccgg ataatgtag

DBGET integrated database retrieval system