Pteropus vampyrus (Indian flying fox): 120605040 Help Entry 120605040         CDS       T07511                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04010   MAPK signaling pathway pgig04014   Ras signaling pathway pgig04015   Rap1 signaling pathway pgig04024   cAMP signaling pathway pgig04062   Chemokine signaling pathway pgig04510   Focal adhesion pgig04517   IgSF CAM signaling pgig04520   Adherens junction pgig04611   Platelet activation pgig04670   Leukocyte transendothelial migration pgig04720   Long-term potentiation pgig04722   Neurotrophin signaling pathway pgig04934   Cushing syndrome pgig04972   Pancreatic secretion pgig05211   Renal cell carcinoma pgig05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120605040 (RAP1B)    04014 Ras signaling pathway     120605040 (RAP1B)    04015 Rap1 signaling pathway     120605040 (RAP1B)    04024 cAMP signaling pathway     120605040 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     120605040 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     120605040 (RAP1B)    04520 Adherens junction     120605040 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     120605040 (RAP1B)    04670 Leukocyte transendothelial migration     120605040 (RAP1B)    04062 Chemokine signaling pathway     120605040 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     120605040 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     120605040 (RAP1B)    04722 Neurotrophin signaling pathway     120605040 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     120605040 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120605040 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     120605040 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pgig04147]     120605040 (RAP1B)    04031 GTP-binding proteins [BR:pgig04031]     120605040 (RAP1B) Exosome [BR:pgig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120605040 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    120605040 (RAP1B)   Exosomal proteins of colorectal cancer cells    120605040 (RAP1B) GTP-binding proteins [BR:pgig04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     120605040 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  120605040 NCBI-ProteinID:  XP_039721891 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaattttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggctttgcgtta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcagaatctagcaagacaatggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcatca tgtcagctcctttaa

DBGET integrated database retrieval system