Pteropus vampyrus (Indian flying fox): 120616686 Help Entry 120616686         CDS       T07511                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04060   Cytokine-cytokine receptor interaction pgig04151   PI3K-Akt signaling pathway pgig04630   JAK-STAT signaling pathway pgig04640   Hematopoietic cell lineage pgig04657   IL-17 signaling pathway pgig04658   Th1 and Th2 cell differentiation pgig04659   Th17 cell differentiation pgig04660   T cell receptor signaling pathway pgig04664   Fc epsilon RI signaling pathway pgig04672   Intestinal immune network for IgA production pgig05140   Leishmaniasis pgig05200   Pathways in cancer pgig05310   Asthma pgig05320   Autoimmune thyroid disease pgig05321   Inflammatory bowel disease pgig05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120616686 (IL4)    04151 PI3K-Akt signaling pathway     120616686 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120616686 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120616686 (IL4)    04660 T cell receptor signaling pathway     120616686 (IL4)    04658 Th1 and Th2 cell differentiation     120616686 (IL4)    04659 Th17 cell differentiation     120616686 (IL4)    04657 IL-17 signaling pathway     120616686 (IL4)    04664 Fc epsilon RI signaling pathway     120616686 (IL4)    04672 Intestinal immune network for IgA production     120616686 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120616686 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     120616686 (IL4)   09163 Immune disease    05310 Asthma     120616686 (IL4)    05320 Autoimmune thyroid disease     120616686 (IL4)    05321 Inflammatory bowel disease     120616686 (IL4)    05330 Allograft rejection     120616686 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120616686 (IL4)    00536 Glycosaminoglycan binding proteins [BR:pgig00536]     120616686 (IL4) Cytokines and neuropeptides [BR:pgig04052]  Cytokines   Interleukins    120616686 (IL4) Glycosaminoglycan binding proteins [BR:pgig00536]  Heparan sulfate / Heparin   Cytokines    120616686 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 DUF4942 AAR2 Motif Other DBs NCBI-GeneID:  120616686 NCBI-ProteinID:  XP_039736275 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MGLTSQLIPALVCLLACTSNFTHGHRYSITLEEIIKTLNILTTRKDWCMELMVADVFAAP KNTAEEEIFCRAVTVLRKVYKHHECVNRKFLGKLDRNLRSMARDYCPVEEAKKDTLKNVL ETLRKTMQEKYSKSWS NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccagctgattccagctctggtgtgcttactagcatgtaccagcaac ttcacccatggacacaggtacagtatcaccttagaagagatcatcaaaacactgaacatc ctcacaacgagaaaggactggtgcatggagctgatggtggcggacgtcttcgctgcccca aagaacacagcggaggaggaaatcttctgcagggctgtgacggtgcttcggaaggtctac aaacaccatgagtgcgtaaacagaaaattcctgggcaaacttgacaggaacctgcgcagc atggccagggactactgtcctgtggaggaagccaagaaggatacattgaaaaacgtcttg gaaacgctaaggaagaccatgcaagagaaatactcaaagagttggagctga

DBGET integrated database retrieval system