Pteropus vampyrus (Indian flying fox): 120618944 Help Entry 120618944         CDS       T07511                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig01523   Antifolate resistance pgig04010   MAPK signaling pathway pgig04060   Cytokine-cytokine receptor interaction pgig04061   Viral protein interaction with cytokine and cytokine receptor pgig04064   NF-kappa B signaling pathway pgig04071   Sphingolipid signaling pathway pgig04150   mTOR signaling pathway pgig04210   Apoptosis pgig04217   Necroptosis pgig04350   TGF-beta signaling pathway pgig04380   Osteoclast differentiation pgig04612   Antigen processing and presentation pgig04620   Toll-like receptor signaling pathway pgig04621   NOD-like receptor signaling pathway pgig04622   RIG-I-like receptor signaling pathway pgig04625   C-type lectin receptor signaling pathway pgig04640   Hematopoietic cell lineage pgig04650   Natural killer cell mediated cytotoxicity pgig04657   IL-17 signaling pathway pgig04660   T cell receptor signaling pathway pgig04664   Fc epsilon RI signaling pathway pgig04668   TNF signaling pathway pgig04920   Adipocytokine signaling pathway pgig04930   Type II diabetes mellitus pgig04931   Insulin resistance pgig04932   Non-alcoholic fatty liver disease pgig04933   AGE-RAGE signaling pathway in diabetic complications pgig04936   Alcoholic liver disease pgig04940   Type I diabetes mellitus pgig05010   Alzheimer disease pgig05014   Amyotrophic lateral sclerosis pgig05020   Prion disease pgig05022   Pathways of neurodegeneration - multiple diseases pgig05132   Salmonella infection pgig05133   Pertussis pgig05134   Legionellosis pgig05135   Yersinia infection pgig05140   Leishmaniasis pgig05142   Chagas disease pgig05143   African trypanosomiasis pgig05144   Malaria pgig05145   Toxoplasmosis pgig05146   Amoebiasis pgig05152   Tuberculosis pgig05160   Hepatitis C pgig05161   Hepatitis B pgig05163   Human cytomegalovirus infection pgig05164   Influenza A pgig05165   Human papillomavirus infection pgig05166   Human T-cell leukemia virus 1 infection pgig05168   Herpes simplex virus 1 infection pgig05169   Epstein-Barr virus infection pgig05170   Human immunodeficiency virus 1 infection pgig05171   Coronavirus disease - COVID-19 pgig05205   Proteoglycans in cancer pgig05310   Asthma pgig05321   Inflammatory bowel disease pgig05322   Systemic lupus erythematosus pgig05323   Rheumatoid arthritis pgig05330   Allograft rejection pgig05332   Graft-versus-host disease pgig05410   Hypertrophic cardiomyopathy pgig05414   Dilated cardiomyopathy pgig05417   Lipid and atherosclerosis pgig05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120618944 (TNF)    04350 TGF-beta signaling pathway     120618944 (TNF)    04064 NF-kappa B signaling pathway     120618944 (TNF)    04668 TNF signaling pathway     120618944 (TNF)    04071 Sphingolipid signaling pathway     120618944 (TNF)    04150 mTOR signaling pathway     120618944 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120618944 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     120618944 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     120618944 (TNF)    04217 Necroptosis     120618944 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120618944 (TNF)    04620 Toll-like receptor signaling pathway     120618944 (TNF)    04621 NOD-like receptor signaling pathway     120618944 (TNF)    04622 RIG-I-like receptor signaling pathway     120618944 (TNF)    04625 C-type lectin receptor signaling pathway     120618944 (TNF)    04650 Natural killer cell mediated cytotoxicity     120618944 (TNF)    04612 Antigen processing and presentation     120618944 (TNF)    04660 T cell receptor signaling pathway     120618944 (TNF)    04657 IL-17 signaling pathway     120618944 (TNF)    04664 Fc epsilon RI signaling pathway     120618944 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     120618944 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     120618944 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     120618944 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120618944 (TNF)    05170 Human immunodeficiency virus 1 infection     120618944 (TNF)    05161 Hepatitis B     120618944 (TNF)    05160 Hepatitis C     120618944 (TNF)    05171 Coronavirus disease - COVID-19     120618944 (TNF)    05164 Influenza A     120618944 (TNF)    05168 Herpes simplex virus 1 infection     120618944 (TNF)    05163 Human cytomegalovirus infection     120618944 (TNF)    05169 Epstein-Barr virus infection     120618944 (TNF)    05165 Human papillomavirus infection     120618944 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     120618944 (TNF)    05135 Yersinia infection     120618944 (TNF)    05133 Pertussis     120618944 (TNF)    05134 Legionellosis     120618944 (TNF)    05152 Tuberculosis     120618944 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     120618944 (TNF)    05144 Malaria     120618944 (TNF)    05145 Toxoplasmosis     120618944 (TNF)    05140 Leishmaniasis     120618944 (TNF)    05142 Chagas disease     120618944 (TNF)    05143 African trypanosomiasis     120618944 (TNF)   09163 Immune disease    05310 Asthma     120618944 (TNF)    05322 Systemic lupus erythematosus     120618944 (TNF)    05323 Rheumatoid arthritis     120618944 (TNF)    05321 Inflammatory bowel disease     120618944 (TNF)    05330 Allograft rejection     120618944 (TNF)    05332 Graft-versus-host disease     120618944 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     120618944 (TNF)    05014 Amyotrophic lateral sclerosis     120618944 (TNF)    05020 Prion disease     120618944 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     120618944 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120618944 (TNF)    05418 Fluid shear stress and atherosclerosis     120618944 (TNF)    05410 Hypertrophic cardiomyopathy     120618944 (TNF)    05414 Dilated cardiomyopathy     120618944 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     120618944 (TNF)    04940 Type I diabetes mellitus     120618944 (TNF)    04936 Alcoholic liver disease     120618944 (TNF)    04932 Non-alcoholic fatty liver disease     120618944 (TNF)    04931 Insulin resistance     120618944 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     120618944 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     120618944 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120618944 (TNF)    00536 Glycosaminoglycan binding proteins [BR:pgig00536]     120618944 (TNF) Cytokines and neuropeptides [BR:pgig04052]  Cytokines   Tumor necrosis fators    120618944 (TNF) Glycosaminoglycan binding proteins [BR:pgig00536]  Heparan sulfate / Heparin   Cytokines    120618944 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  120618944 NCBI-ProteinID:  XP_039739035 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSTESMIRDVELAEEELPKKAGGPQASRRCLCLSLFSFLLVAGATMLFCLLHFGVIGPQR EEFPTGLPLIKPLAQTLGLSSRTPSDKPVAHVVANPQAEGQLQWLSQRANALLANGMKLT DNQLVVPLDGLYLIYSQVLFKGQGCPQTHVLLTHTISRFADSYQTKVNLLSAIKSPCQRE TQEGAAAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggatgtggagctggctgaggaggaactccccaagaag gcaggggggccccaggcctccagacggtgcctgtgcctcagcctcttctccttcctcctc gtggcaggagccaccatgctcttctgcctgctgcacttcggagtgattggcccccagaga gaagagttcccgactggcctcccactaatcaaacctctggcccagactcttggattatct tctcgaaccccaagtgacaagcctgtcgcccatgttgtagcaaacccccaagccgaggga cagctccagtggctgagccagcgtgccaatgctctcctggccaatggcatgaagctgaca gacaaccagctggtggtgccattagatgggctgtacctcatctactcccaggtcctcttc aaaggtcaaggctgccctcaaacccatgtactcctcacccacaccatcagccgcttcgct gactcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggaa acccaagagggggctgcggccaagccctggtatgagcccatctacctgggaggagtcttc cagctagagaagggtgatcgactcagtgccgagatcaacctgcctgactatcttgacttt gctgagtctgggcaggtctactttgggatcattgccttgtga

DBGET integrated database retrieval system