Pteropus vampyrus (Indian flying fox): 120619517 Help Entry 120619517         CDS       T07511                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig01522   Endocrine resistance pgig04010   MAPK signaling pathway pgig04024   cAMP signaling pathway pgig04210   Apoptosis pgig04380   Osteoclast differentiation pgig04620   Toll-like receptor signaling pathway pgig04657   IL-17 signaling pathway pgig04658   Th1 and Th2 cell differentiation pgig04659   Th17 cell differentiation pgig04660   T cell receptor signaling pathway pgig04662   B cell receptor signaling pathway pgig04668   TNF signaling pathway pgig04713   Circadian entrainment pgig04725   Cholinergic synapse pgig04728   Dopaminergic synapse pgig04915   Estrogen signaling pathway pgig04917   Prolactin signaling pathway pgig04921   Oxytocin signaling pathway pgig04926   Relaxin signaling pathway pgig04928   Parathyroid hormone synthesis, secretion and action pgig04932   Non-alcoholic fatty liver disease pgig04935   Growth hormone synthesis, secretion and action pgig05031   Amphetamine addiction pgig05132   Salmonella infection pgig05133   Pertussis pgig05135   Yersinia infection pgig05140   Leishmaniasis pgig05142   Chagas disease pgig05161   Hepatitis B pgig05162   Measles pgig05166   Human T-cell leukemia virus 1 infection pgig05167   Kaposi sarcoma-associated herpesvirus infection pgig05170   Human immunodeficiency virus 1 infection pgig05171   Coronavirus disease - COVID-19 pgig05200   Pathways in cancer pgig05207   Chemical carcinogenesis - receptor activation pgig05208   Chemical carcinogenesis - reactive oxygen species pgig05210   Colorectal cancer pgig05224   Breast cancer pgig05231   Choline metabolism in cancer pgig05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pgig05323   Rheumatoid arthritis pgig05417   Lipid and atherosclerosis pgig05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120619517 (FOS)    04668 TNF signaling pathway     120619517 (FOS)    04024 cAMP signaling pathway     120619517 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     120619517 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120619517 (FOS)    04660 T cell receptor signaling pathway     120619517 (FOS)    04658 Th1 and Th2 cell differentiation     120619517 (FOS)    04659 Th17 cell differentiation     120619517 (FOS)    04657 IL-17 signaling pathway     120619517 (FOS)    04662 B cell receptor signaling pathway     120619517 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     120619517 (FOS)    04917 Prolactin signaling pathway     120619517 (FOS)    04921 Oxytocin signaling pathway     120619517 (FOS)    04926 Relaxin signaling pathway     120619517 (FOS)    04935 Growth hormone synthesis, secretion and action     120619517 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     120619517 (FOS)   09156 Nervous system    04725 Cholinergic synapse     120619517 (FOS)    04728 Dopaminergic synapse     120619517 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     120619517 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     120619517 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120619517 (FOS)    05207 Chemical carcinogenesis - receptor activation     120619517 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     120619517 (FOS)    05231 Choline metabolism in cancer     120619517 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120619517 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     120619517 (FOS)    05224 Breast cancer     120619517 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120619517 (FOS)    05170 Human immunodeficiency virus 1 infection     120619517 (FOS)    05161 Hepatitis B     120619517 (FOS)    05171 Coronavirus disease - COVID-19     120619517 (FOS)    05162 Measles     120619517 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     120619517 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     120619517 (FOS)    05135 Yersinia infection     120619517 (FOS)    05133 Pertussis     120619517 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     120619517 (FOS)    05142 Chagas disease     120619517 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     120619517 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     120619517 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120619517 (FOS)    05418 Fluid shear stress and atherosclerosis     120619517 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     120619517 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     120619517 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pgig03000]     120619517 (FOS)    04131 Membrane trafficking [BR:pgig04131]     120619517 (FOS) Transcription factors [BR:pgig03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     120619517 (FOS) Membrane trafficking [BR:pgig04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     120619517 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 HALZ Macoilin Motif Other DBs NCBI-GeneID:  120619517 NCBI-ProteinID:  XP_039739767 UniProt:  A0A6P3QRD6 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNGQDFCTDLASSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTVTGSRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSMASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPAKNISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCATYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctccggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccagccggggacagtctctcctactaccactcaccggccgactctttctctagcatg ggctctcctgtcaacggacaggacttctgcactgatctggcctcctccagtgccaacttc atcccaactgtgactgccatctcaaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccatcccagaccagagcccctcacccctatggagttcccacc ccctcagctggggcttactccagagctggagtcatgaagactgtgacaggaagcagagct cagagcattggcaggaggggcaaggtagaacagttgtccccagaagaggaagagaaaagg agaatccgtagagaaaggaataagatggctgcagccaaatgcaggaaccggagaagggag ctgactgacacactccaagcggagacagaccaattagaagatgagaagtctgctttgcag actgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctaggcttcccagaagagatgtctatggcttcc cttgatctgagtgggggcctgcctgaggctgccacccctgagtctgaggaggccttcacc ctgcccctcctcaatgaccctgagcctaagccctcagtggagcctgccaagaacatcagc agcatggagctgaaggctgagccctttgatgacttcctgttcccagcatcatccaggccc agtggctctgagaccgcccgctctgtgccagacatggatctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg gagcccctgtgcaccccggtggtcacctgtactcccagctgcgctacttacacgtcttcc tttgtcttcacctaccccgaagctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcactgagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system