Pteropus vampyrus (Indian flying fox): 120621996 Help Entry 120621996         CDS       T07511                                  Symbol IL18 Name (RefSeq) interleukin-18   KO K05482   interleukin 18 Organism pgig  Pteropus vampyrus (Indian flying fox) Pathway pgig04060   Cytokine-cytokine receptor interaction pgig04061   Viral protein interaction with cytokine and cytokine receptor pgig04621   NOD-like receptor signaling pathway pgig04623   Cytosolic DNA-sensing pathway pgig05132   Salmonella infection pgig05134   Legionellosis pgig05135   Yersinia infection pgig05143   African trypanosomiasis pgig05144   Malaria pgig05152   Tuberculosis pgig05164   Influenza A pgig05321   Inflammatory bowel disease pgig05323   Rheumatoid arthritis pgig05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pgig00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120621996 (IL18)    04061 Viral protein interaction with cytokine and cytokine receptor     120621996 (IL18)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120621996 (IL18)    04623 Cytosolic DNA-sensing pathway     120621996 (IL18)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     120621996 (IL18)   09171 Infectious disease: bacterial    05132 Salmonella infection     120621996 (IL18)    05135 Yersinia infection     120621996 (IL18)    05134 Legionellosis     120621996 (IL18)    05152 Tuberculosis     120621996 (IL18)   09174 Infectious disease: parasitic    05144 Malaria     120621996 (IL18)    05143 African trypanosomiasis     120621996 (IL18)   09163 Immune disease    05323 Rheumatoid arthritis     120621996 (IL18)    05321 Inflammatory bowel disease     120621996 (IL18)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120621996 (IL18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pgig04052]     120621996 (IL18) Cytokines and neuropeptides [BR:pgig04052]  Cytokines   Interleukins    120621996 (IL18) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 RMP Motif Other DBs NCBI-GeneID:  120621996 NCBI-ProteinID:  XP_039743849 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAEPVEDDCISFVEMKFIDNTLYFVAENDENLESDYFGKLEPRFSIIRNLNNQVLFIYE GNTAVFEDMPDSDCTDNAPQTEFIIYMYKDSLTRGLAVAICVKCNKISTLSCDNKIISFK EMNPPDNINDDGNDIIFFKRSVPGHTDKIQFESSLYKGYFLACKKENDLFKLILKEKDKY GDESVMFTVQELD NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgctgaaccagtagaagacgattgcatcagctttgtggaaatgaaatttattgac aatacactttactttgtagctgaaaatgatgaaaacctggaatcagattactttggcaag ctcgaacctagattctcgatcatacgaaatttgaataaccaagttctcttcatttacgag ggaaacacagctgtgtttgaagatatgcctgattctgactgtacagataatgcaccccag accgaatttatcatatatatgtataaagacagcctcactagaggtctggcggtagccatc tgtgtgaagtgtaataaaatttctactctctcctgtgacaacaaaattatttcctttaag gaaatgaatcctcctgataatatcaatgatgacggaaatgacatcatattctttaagaga agtgtcccaggacatacggataagatacaatttgagtcttcattgtacaaaggatacttt ctagcttgtaaaaaagagaatgaccttttcaaactcattttgaaagaaaaagacaaatat ggggatgaatctgtaatgttcactgttcaagaactagattaa

DBGET integrated database retrieval system