Puccinia graminis: PGTG_18192 Help Entry PGTG_18192        CDS       T02226                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pgr  Puccinia graminis Pathway pgr03420   Nucleotide excision repair pgr04111   Cell cycle - yeast pgr04120   Ubiquitin mediated proteolysis pgr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     PGTG_18192    04120 Ubiquitin mediated proteolysis     PGTG_18192   09124 Replication and repair    03420 Nucleotide excision repair     PGTG_18192  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     PGTG_18192  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pgr04121]     PGTG_18192    03400 DNA repair and recombination proteins [BR:pgr03400]     PGTG_18192 Enzymes [BR:pgr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      PGTG_18192 Ubiquitin system [BR:pgr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    PGTG_18192   Multi subunit type E3    SCF complex     Ring finger protein      PGTG_18192    Cul2 complex      PGTG_18192    Cul3 complex      PGTG_18192    Cul4 complex      PGTG_18192    Cul7 complex      PGTG_18192    Cul8 complex      PGTG_18192    Cul9 complex      PGTG_18192 DNA repair and recombination proteins [BR:pgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       PGTG_18192     TCR (transcription coupled repair) factors      Cul4-CSA complex       PGTG_18192 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 PHD_NSD zf-RING_16 Motif Other DBs NCBI-GeneID:  10539007 NCBI-ProteinID:  XP_003337096 UniProt:  E3L802 LinkDB All DBs AA seq 113 aa AA seqDB search MADSMDVDQNSVTKPDPEPTSKEQKRFVVKKWNAVALWAWDIIVDNCAICRNHIMDLCIE CQANQASATNEECTVAWGTCNHAFHFHCISRWLKTRQVCPLDNREWELQKYGR NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcagattcgatggacgtagaccagaattcagtcaccaaacctgacccagaaccaact tccaaggagcaaaaaagatttgtggtcaagaagtggaatgccgtagccctgtgggcctgg gatatcattgttgataattgtgcgatttgcaggaatcacatcatggacctttgtatcgaa tgtcaagccaatcaggcgagtgcgaccaacgaggaatgtacggttgcttggggaacttgt aatcatgctttccatttccactgtatctcgaggtggcttaaaactcgtcaagtttgtccc cttgataatcgggaatgggaactccaaaagtatggtcgatga

DBGET integrated database retrieval system