Pyricularia grisea: PgNI_04562 Help Entry PgNI_04562        CDS       T09406                                  Name (RefSeq) uncharacterized protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pgri  Pyricularia grisea Pathway pgri03420   Nucleotide excision repair pgri04111   Cell cycle - yeast pgri04120   Ubiquitin mediated proteolysis pgri04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pgri00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     PgNI_04562    04120 Ubiquitin mediated proteolysis     PgNI_04562   09124 Replication and repair    03420 Nucleotide excision repair     PgNI_04562  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     PgNI_04562  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pgri04121]     PgNI_04562    03400 DNA repair and recombination proteins [BR:pgri03400]     PgNI_04562 Enzymes [BR:pgri01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      PgNI_04562 Ubiquitin system [BR:pgri04121]  Ubiquitin ligases (E3)   UBL E3 ligases    PgNI_04562   Multi subunit type E3    SCF complex     Ring finger protein      PgNI_04562    Cul2 complex      PgNI_04562    Cul3 complex      PgNI_04562    Cul4 complex      PgNI_04562    Cul7 complex      PgNI_04562    Cul8 complex      PgNI_04562    Cul9 complex      PgNI_04562 DNA repair and recombination proteins [BR:pgri03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       PgNI_04562     TCR (transcription coupled repair) factors      Cul4-CSA complex       PgNI_04562 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  41959516 NCBI-ProteinID:  XP_030983732 UniProt:  A0A6P8B960 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MTDVDMTDAPGGAGPVAKKKGGDAAAGEGKKRFEVKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGICNHAFHFHCISRWLKARQVCPLDNRDWEFQKYGR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaccgacgttgacatgacagacgcgccaggtggcgcaggccctgtggccaagaagaag ggcggagatgccgccgcgggcgagggcaagaagcgatttgaggtcaagaagtggaacgcc gttgcgctctgggcctgggacattgtcgtcgacaactgcgccatctgcaggaatcacatt atggatctttgtattgaatgccaggcaaaccaagcatccgccacgagtgaggagtgcacc gttgcctggggtatctgcaatcacgctttccactttcactgcatttcgaggtggctgaag gcacgacaagtctgtcccctggataaccgtgactgggagttccaaaagtatggtcgttga

DBGET integrated database retrieval system