Pantherophis guttatus (corn snake): 117655425 Help Entry 117655425         CDS       T07329                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pgut  Pantherophis guttatus (corn snake) Pathway pgut03420   Nucleotide excision repair pgut04110   Cell cycle pgut04114   Oocyte meiosis pgut04120   Ubiquitin mediated proteolysis pgut04141   Protein processing in endoplasmic reticulum pgut04310   Wnt signaling pathway pgut04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pgut00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117655425 (RBX1)    04120 Ubiquitin mediated proteolysis     117655425 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     117655425 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     117655425 (RBX1)    04350 TGF-beta signaling pathway     117655425 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     117655425 (RBX1)    04114 Oocyte meiosis     117655425 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pgut04121]     117655425 (RBX1)    03400 DNA repair and recombination proteins [BR:pgut03400]     117655425 (RBX1) Enzymes [BR:pgut01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      117655425 (RBX1) Ubiquitin system [BR:pgut04121]  Ubiquitin ligases (E3)   UBL E3 ligases    117655425 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      117655425 (RBX1)    Cul2 complex      117655425 (RBX1)    Cul3 complex      117655425 (RBX1)    Cul4 complex      117655425 (RBX1)    Cul7 complex      117655425 (RBX1)    Cul8 complex      117655425 (RBX1)    Cul9 complex      117655425 (RBX1) DNA repair and recombination proteins [BR:pgut03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       117655425 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       117655425 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  117655425 NCBI-ProteinID:  XP_034258767 UniProt:  A0A6P9AJQ1 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctgccgcgatggatgttgacactccgagtggcaccaacagcggtgccggtaaaaag cgctttgaagtaaagaagtggaatgcagttgccctttgggcttgggacatcgttgttgac aactgtgcaatatgcagaaatcatattatggatctctgtatagaatgccaagctaaccaa gcatcagctacctcggaagaatgcactgttgcatggggtgtttgtaatcacgctttccat tttcattgcatttcccgctggcttaagactcggcaggtatgcccattagataatcgagaa tgggagtttcagaagtatggacattag

DBGET integrated database retrieval system