Panicum hallii (Hall's panicgrass): 112893014 Help Entry 112893014         CDS       T07366                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism phai  Panicum hallii (Hall's panicgrass) Pathway phai03420   Nucleotide excision repair phai04120   Ubiquitin mediated proteolysis phai04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:phai00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     112893014    04120 Ubiquitin mediated proteolysis     112893014   09124 Replication and repair    03420 Nucleotide excision repair     112893014  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:phai04121]     112893014    03400 DNA repair and recombination proteins [BR:phai03400]     112893014 Enzymes [BR:phai01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      112893014 Ubiquitin system [BR:phai04121]  Ubiquitin ligases (E3)   UBL E3 ligases    112893014   Multi subunit type E3    SCF complex     Ring finger protein      112893014    Cul2 complex      112893014    Cul3 complex      112893014    Cul4 complex      112893014    Cul7 complex      112893014    Cul8 complex      112893014    Cul9 complex      112893014 DNA repair and recombination proteins [BR:phai03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       112893014     TCR (transcription coupled repair) factors      Cul4-CSA complex       112893014 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  112893014 NCBI-ProteinID:  XP_025815934 LinkDB All DBs Position 5:53079217..53081695 Genome browser AA seq 126 aa AA seqDB search MSAMETDINAPPPPAPAPAGEGSSAAGPSSSSSRKPNKRFEIKKWNAVALWAWDIVVDNC AICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWE FQKYGH NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtccgccatggagaccgacatcaacgcgccgccgccgcccgcccccgcccccgccggc gagggctcctccgcggccggcccgtcctcatcctcctcccgcaagcccaacaagcgcttc gagatcaagaagtggaacgccgtcgcgctctgggcatgggatatcgtcgtcgataactgc gccatctgccgcaaccacatcatggatctatgcatcgagtgccaggcaaaccaggccagc gccaccagcgaggagtgcactgtcgcttggggtgtctgtaatcatgcttttcacttccac tgcatcagcaggtggcttaagactcgccaagtgtgcccattagacaacagtgagtgggag ttccagaaatatggccactag

DBGET integrated database retrieval system