Porcisia hertigi: 94291023 Help Entry 94291023          CDS       T10408                                  Symbol JKF63_04976 Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism phet  Porcisia hertigi Pathway phet03420   Nucleotide excision repair phet04120   Ubiquitin mediated proteolysis phet04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:phet00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     94291023 (JKF63_04976)    04120 Ubiquitin mediated proteolysis     94291023 (JKF63_04976)   09124 Replication and repair    03420 Nucleotide excision repair     94291023 (JKF63_04976)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:phet04121]     94291023 (JKF63_04976)    03400 DNA repair and recombination proteins [BR:phet03400]     94291023 (JKF63_04976) Enzymes [BR:phet01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      94291023 (JKF63_04976) Ubiquitin system [BR:phet04121]  Ubiquitin ligases (E3)   UBL E3 ligases    94291023 (JKF63_04976)   Multi subunit type E3    SCF complex     Ring finger protein      94291023 (JKF63_04976)    Cul2 complex      94291023 (JKF63_04976)    Cul3 complex      94291023 (JKF63_04976)    Cul4 complex      94291023 (JKF63_04976)    Cul7 complex      94291023 (JKF63_04976)    Cul8 complex      94291023 (JKF63_04976)    Cul9 complex      94291023 (JKF63_04976) DNA repair and recombination proteins [BR:phet03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       94291023 (JKF63_04976)     TCR (transcription coupled repair) factors      Cul4-CSA complex       94291023 (JKF63_04976) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_5 RING_XB3-XBAT31 Motif Other DBs NCBI-GeneID:  94291023 NCBI-ProteinID:  XP_067757309 UniProt:  A0A836LB11 LinkDB All DBs Position 21:<4891..>5211 Genome browser AA seq 106 aa AA seqDB search MEPKEETGTSTAVEDSKGSRFQLKKWNAVALWSWDIQVDTCAICRNHIMDLCIECQSNLS CSSKDCTVVWGACNHAFHVHCISRWLKTRNVCPLDNKEWVYQRYGA NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggagccgaaagaggagacaggcacctcgaccgcagtggaagatagtaaaggaagtcgg tttcaactgaagaaatggaacgctgttgcgctttggtcgtgggatattcaggtggacacc tgcgccatctgtagaaatcacattatggacttgtgtatcgaatgccagtcgaatctgtcg tgttcatctaaggactgcacggttgtttggggtgcctgcaatcacgcctttcatgtgcat tgcatttctcgatggttgaagacgcggaatgtgtgtcctttggacaataaggagtgggtt taccagcgatacggcgcctga

DBGET integrated database retrieval system