KEGG   Pyrococcus horikoshii: PH0634
Entry
PH0634            CDS       T00014                                 

Gene name
PH0634
Definition
(GenBank) 115aa long hypothetical protein
  KO
K22102  dihydroneopterin phosphate aldolase [EC:4.1.2.59]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PH0634 (PH0634)
Enzymes [BR:pho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.59  dihydroneopterin phosphate aldolase
     PH0634 (PH0634)
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-ProteinID: BAA29724
UniProt: O58368
LinkDB
Structure
PDB: 
2DJ6 2DTT

Position
569476..569823
AA seq 115 aa
MKSRIIVRTSFDAAHAVKVGDHWEDVHGHTFFLEVAIEGEIKNGYVMDFLELRKIVEEIT
KELDHRNLNNIFENPTTENIALWIGERIRDKLPPYVKLKRVVLWEGKDNGVELEW
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaagagcagaataatagttaggacgagttttgatgctgcacatgctgttaaagttggg
gatcactgggaagatgtacatgggcataccttcttccttgaggttgccattgaaggggag
ataaagaacggttatgtcatggatttccttgaacttaggaagatagtggaagagataacg
aaggaactggatcataggaaccttaataacatttttgagaatccaactaccgagaatatt
gcactctggataggggagagaattagggataaattaccgccttatgtaaagctgaaaaga
gtagtgctgtgggaaggaaaagataacggggtggaattggagtggtaa

DBGET integrated database retrieval system