KEGG   Pyrococcus horikoshii: PH1722
Entry
PH1722            CDS       T00014                                 

Gene name
PH1722
Definition
(GenBank) 323aa long hypothetical 3-isopropylmalate dehydrogenase
  KO
K17753  isocitrate--homoisocitrate dehydrogenase [EC:1.1.1.286]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00020  Citrate cycle (TCA cycle)
pho00300  Lysine biosynthesis
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01120  Microbial metabolism in diverse environments
pho01210  2-Oxocarboxylic acid metabolism
pho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PH1722 (PH1722)
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PH1722 (PH1722)
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.286  isocitrate---homoisocitrate dehydrogenase
     PH1722 (PH1722)
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-ProteinID: BAA30836
UniProt: O59394
LinkDB
Position
complement(1512308..1513279)
AA seq 323 aa
MVKSVTDKIKFYEFEGGLSVFKKYGVPIREEDLEEIRKMDAILFGATTTPFDVPRYKSLI
ITLRKELDLYANLRIIPNFKLRKEIIIVRENSEGLYSGEGAYDSNKVVDFRIITRKGAER
IAKFAVKLAKDRSTFLTFVHKANILESDRFFRKIVLDIARKEDVKVREEIVDSFTIKLVK
DPWNLGIILSENMFGDILSDLATIHAGSIGIVPSGNYGEDIALFEPIHGSAPDIAGKGIA
NPIGAILSAAMMLDYLGLDGSIIWKAVGRYVRRGNLTPDMEGRATTLEVTNGIISEIYRL
DEYEIDEVWRDEVRLGRILLEIS
NT seq 972 nt   +upstreamnt  +downstreamnt
gtggtaaaatctgtgacagataaaattaaattttatgaattcgaagggggtttaagtgtt
tttaaaaaatatggggtgccaatcagggaggaggatctcgaggaaattaggaagatggat
gctatattatttggagcaacgacgacaccctttgatgttcctagatataagagcttaatt
ataacgttgaggaaggaacttgacttgtacgcaaatctaaggataattccaaactttaag
ttgagaaaagagataattatagttagagaaaatagtgaagggctatacagtggagaagga
gcatacgatagtaacaaggtagttgactttaggataataacaaggaaaggtgcggagagg
atagctaaatttgcagtaaaacttgcaaaagataggagcaccttcttaacctttgttcat
aaggcaaacatacttgagagtgatagattcttcagaaaaattgtcctagacattgctagg
aaggaagatgttaaagttagagaagaaatagttgactcttttacaataaagttagtgaaa
gacccttggaacttgggaataatcctttctgaaaatatgtttggtgacatcctttcagat
ctggcaacgatacatgctggtagcatcgggatcgttcccagcggaaactatggggaggat
atagcattgtttgagccaatacatggctctgctccggatatagctggcaagggaatagca
aatccaataggggcaatactgagtgctgcaatgatgctggattaccttggtttagatggt
tctatcatctggaaagctgttgggaggtatgtgaggagaggaaacctaacaccggatatg
gaggggagagcaacaactctggaggttactaatgggataatctcggagatatatcgcttg
gatgagtacgaaatagatgaggtttggagggatgaagttagacttgggaggatactgctc
gagataagttaa

DBGET integrated database retrieval system