Paenarthrobacter sp. R1: QN084_11395 Help Entry QN084_11395       CDS       T10646                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism phrz  Paenarthrobacter sp. R1 Pathway phrz00790   Folate biosynthesis phrz01100   Metabolic pathways phrz01240   Biosynthesis of cofactors Module phrz_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:phrz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     QN084_11395 (folB) Enzymes [BR:phrz01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      QN084_11395 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      QN084_11395 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      QN084_11395 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  WIV33166 LinkDB All DBs Position 2346534..2346893 Genome browser AA seq 119 aa AA seqDB search MDRITLTGVTAVGHHGVFDFERREGQPFVVDAVLYTDFTKAAETDDLQFTAHYGEVAGLI TKHIEGEPLNLIEGLAVRIAEDILANYGVSAVDVTVHKPKAPIEVPFGDVAVSVHRERT NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtggacaggatcacgctgaccggtgtcaccgccgtcggccaccatggagtgttcgacttc gaacgccgtgagggccagccattcgtggtggatgcggtgctttacacggacttcaccaag gccgccgagacggacgatctgcagttcacagcgcattatggcgaggtggccgggctcatc accaagcacatcgagggtgagccgttgaacctgattgagggccttgccgtacgcatcgcg gaggacatcctggccaattacggtgtgtccgccgtcgacgtgacggttcataagcccaag gcgcccattgaggtgccgttcggggacgtcgctgtcagcgtgcatcgggagcggacatga

DBGET integrated database retrieval system