Primulina huaijiensis: 140962257 Help Entry 140962257         CDS       T11038                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism phua  Primulina huaijiensis Pathway phua03420   Nucleotide excision repair phua04120   Ubiquitin mediated proteolysis phua04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:phua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     140962257    04120 Ubiquitin mediated proteolysis     140962257   09124 Replication and repair    03420 Nucleotide excision repair     140962257  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:phua04121]     140962257    03400 DNA repair and recombination proteins [BR:phua03400]     140962257 Enzymes [BR:phua01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      140962257 Ubiquitin system [BR:phua04121]  Ubiquitin ligases (E3)   UBL E3 ligases    140962257   Multi subunit type E3    SCF complex     Ring finger protein      140962257    Cul2 complex      140962257    Cul3 complex      140962257    Cul4 complex      140962257    Cul7 complex      140962257    Cul8 complex      140962257    Cul9 complex      140962257 DNA repair and recombination proteins [BR:phua03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       140962257     TCR (transcription coupled repair) factors      Cul4-CSA complex       140962257 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  140962257 NCBI-ProteinID:  XP_073277205 LinkDB All DBs Position 17:7509250..7512073 Genome browser AA seq 127 aa AA seqDB search MASLDTDVNMIPAGEGSSDAGPSNTAPTSAPSQSAKKAKRFEIKKWNAVALWAWDIVVDN CAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEW EFQKYGH NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgctggacaccgacgtgaatatgatccccgccggagagggttcttccgatgct gggccatccaacactgctcccacgtcggcgccgtcgcaatccgccaagaaagccaagcga tttgagatcaagaagtggaacgcagtcgctctctgggcttgggatattgtggtcgataat tgtgctatttgcaggaatcatatcatggatctgtgcatcgagtgtcaggctaatcaagct agcgcgaccagtgaggagtgcactgttgcttggggtgtttgcaatcatgccttccatttc cactgcatcagcagatggctcaagactcgccaagtttgccccttggacaatagtgagtgg gagtttcagaagtatggtcactaa

DBGET integrated database retrieval system