Primulina huaijiensis: 140971466 Help Entry 140971466         CDS       T11038                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism phua  Primulina huaijiensis Pathway phua03420   Nucleotide excision repair phua04120   Ubiquitin mediated proteolysis phua04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:phua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     140971466    04120 Ubiquitin mediated proteolysis     140971466   09124 Replication and repair    03420 Nucleotide excision repair     140971466  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:phua04121]     140971466    03400 DNA repair and recombination proteins [BR:phua03400]     140971466 Enzymes [BR:phua01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      140971466 Ubiquitin system [BR:phua04121]  Ubiquitin ligases (E3)   UBL E3 ligases    140971466   Multi subunit type E3    SCF complex     Ring finger protein      140971466    Cul2 complex      140971466    Cul3 complex      140971466    Cul4 complex      140971466    Cul7 complex      140971466    Cul8 complex      140971466    Cul9 complex      140971466 DNA repair and recombination proteins [BR:phua03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       140971466     TCR (transcription coupled repair) factors      Cul4-CSA complex       140971466 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  140971466 NCBI-ProteinID:  XP_073289846 LinkDB All DBs Position 2:29744413..29746875 Genome browser AA seq 127 aa AA seqDB search MASLDTDVNMIPAGEGSSGAGPSNTAPTPVPSQSAKKAKRFEIKKWNAVSLWAWDIVVDN CAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEW EFQKYGH NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgctggacaccgacgtgaatatgatccccgccggagagggatcttccggcgct gggccctccaacactgcccccacgccagtgccgtcgcaatccgccaagaaagccaagcga tttgagatcaagaagtggaacgccgtctctctctgggcttgggatatcgtggtcgataac tgtgctatttgcaggaatcatattatggatctctgcatagagtgtcaggctaatcaagct agtgcgaccagtgaagagtgcactgttgcttggggtgtttgcaatcatgccttccatttc cactgcatcagcagatggctcaagactcgtcaagtttgccccttggacaatagtgagtgg gagtttcagaagtatggtcactaa

DBGET integrated database retrieval system