Paramormyrops kingsleyae: 111834515 Help Entry 111834515         CDS       T05788                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pki  Paramormyrops kingsleyae Pathway pki00510   N-Glycan biosynthesis pki00513   Various types of N-glycan biosynthesis pki04141   Protein processing in endoplasmic reticulum Module pki_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pki00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     111834515 (tmem258)    00513 Various types of N-glycan biosynthesis     111834515 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111834515 (tmem258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  111834515 NCBI-ProteinID:  XP_023649653 Ensembl:  ENSPKIG00000020111 UniProt:  A0A3B3Q7A2 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgacgcgatacaccagcccggtgaatccggcagtgtttccacac ctcacggttgttctgctggccatcggaatgttcttcacagcctggtttttcgtctatgaa gtaacctccacaaagtacacacgggacgtctacaaggagctcctcatctccctggtggcc tcgctcttcatgggctttggggttctcttcctgctgctgtgggttggcatctacgtatga

DBGET integrated database retrieval system