Paramormyrops kingsleyae: 111845210 Help Entry 111845210         CDS       T05788                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pki  Paramormyrops kingsleyae Pathway pki03420   Nucleotide excision repair pki04110   Cell cycle pki04114   Oocyte meiosis pki04120   Ubiquitin mediated proteolysis pki04141   Protein processing in endoplasmic reticulum pki04310   Wnt signaling pathway pki04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:pki00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111845210 (rbx1)    04120 Ubiquitin mediated proteolysis     111845210 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     111845210 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     111845210 (rbx1)    04350 TGF-beta signaling pathway     111845210 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     111845210 (rbx1)    04114 Oocyte meiosis     111845210 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pki04121]     111845210 (rbx1)    03400 DNA repair and recombination proteins [BR:pki03400]     111845210 (rbx1) Enzymes [BR:pki01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111845210 (rbx1) Ubiquitin system [BR:pki04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111845210 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      111845210 (rbx1)    Cul2 complex      111845210 (rbx1)    Cul3 complex      111845210 (rbx1)    Cul4 complex      111845210 (rbx1)    Cul7 complex      111845210 (rbx1)    Cul8 complex      111845210 (rbx1)    Cul9 complex      111845210 (rbx1) DNA repair and recombination proteins [BR:pki03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111845210 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       111845210 (rbx1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  111845210 NCBI-ProteinID:  XP_023670206 Ensembl:  ENSPKIG00000003639 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDAPACINSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcgatggatgtagatgctccggcttgcatcaatagtggggcaagcaaaaag cgttttgaagtaaagaagtggaatgctgtggccctctgggcctgggacatcgtagttgac aactgtgccatttgtaggaaccacatcatggacctctgcattgagtgtcaagccaatcag gcgtcagccaccagcgaggagtgcaccgtagcctggggggtctgcaatcacgccttccat ttccactgtatctctcgctggctgaagaccaggcaggtgtgtcctctagataacagggag tgggagtttcagaagtatggacactag

DBGET integrated database retrieval system