Paramormyrops kingsleyae: 111846921 Help Entry 111846921         CDS       T05788                                  Symbol il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism pki  Paramormyrops kingsleyae Pathway pki04060   Cytokine-cytokine receptor interaction pki04068   FoxO signaling pathway pki04218   Cellular senescence pki04620   Toll-like receptor signaling pathway pki04621   NOD-like receptor signaling pathway pki04623   Cytosolic DNA-sensing pathway pki04625   C-type lectin receptor signaling pathway pki04672   Intestinal immune network for IgA production pki05132   Salmonella infection pki05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pki00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     111846921 (il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111846921 (il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     111846921 (il6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111846921 (il6)    04621 NOD-like receptor signaling pathway     111846921 (il6)    04623 Cytosolic DNA-sensing pathway     111846921 (il6)    04625 C-type lectin receptor signaling pathway     111846921 (il6)    04672 Intestinal immune network for IgA production     111846921 (il6)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     111846921 (il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     111846921 (il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pki04052]     111846921 (il6) Cytokines and neuropeptides [BR:pki04052]  Cytokines   Interleukins    111846921 (il6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL11 IL23 Motif Other DBs NCBI-GeneID:  111846921 NCBI-ProteinID:  XP_023673422 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MQSLPFTFALLPLAVLIAHGAPCVSHLEDASDTSGDGSLDPTSRNLEHLSAVLVCLIGSL RDEHFAKNWPQESMSSYKDHKITMPYLNVEDGCFSLKFNKKRCLSGIASKLQLYRPYLDF VKIENPGSSKVDDVISRTDTLTRSIKDKLPKVEESDSSSQGALPTLPSDKTEWERKITVH VILRELGVFMAETHRAVRFINRRP NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgcagagtctccctttcacttttgcactgctgcctctcgcagtgctgattgcccatgga gccccctgcgtcagccacctggaagacgcctcagacacctctggggatggcagcctcgac ccgacgtctaggaatctggagcatctttcggcagttctcgtctgcctgatcggcagtctc cgtgatgagcactttgcgaaaaattggccgcaagaaagcatgtcgtcgtacaaggaccac aaaatcacaatgccttacctgaacgtggaggacggctgtttttctcttaaattcaacaaa aaaaggtgtttgagtgggattgcgagcaaactgcagctgtacagaccctacctggatttt gtgaagatagagaatccgggatccagcaaggttgatgacgttatctccaggacagacacc ttaactcgcagtataaaagataaactgccgaaggtggaggagtcggactcgagctcgcag ggcgcgctcccgacgctgccctccgacaagaccgagtgggagcgaaagatcacggtgcac gtgattctcagggagctcggcgtcttcatggcggagacgcacagggccgtccgcttcatc aatcggcgcccgtga

DBGET integrated database retrieval system