Paucibacter sp. KCTC 42545: AT984_01280 Help Entry AT984_01280       CDS       T04227                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pkt  Paucibacter sp. KCTC 42545 Pathway pkt00790   Folate biosynthesis pkt01100   Metabolic pathways pkt01240   Biosynthesis of cofactors Module pkt_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pkt00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AT984_01280 Enzymes [BR:pkt01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AT984_01280  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AT984_01280  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AT984_01280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ALT79539 UniProt:  A0A0U2URR0 LinkDB All DBs Position complement(294531..294899) Genome browser AA seq 122 aa AA seqDB search MRRNNRQIIHITGLRFGANLGVLDFEREGPQPIQVDAEVNLGAQTIVSRDADIGHVLDYR RVRTIIIDECTAEHTDLLEALLGKLCTRLMSLHGVVGVRIKVTKLEIFPDCQVAISAECG QW NT seq 369 nt NT seq  +upstreamnt  +downstreamnt ctgcgccgcaacaaccgccagatcattcacatcaccggcctgcgcttcggcgccaatctc ggcgtgctggactttgagcgcgaagggccacagccgattcaggtcgatgccgaggtcaat ctgggcgcgcagaccattgtttcgcgcgatgccgatatcggccatgtgctggactaccgc cgtgtgcgcaccatcatcattgacgaatgcaccgccgagcacaccgacctgctcgaagcc ctgctgggcaagctctgcacccgcttgatgagcttgcatggcgtggtgggcgtgcgcatc aaagtgaccaagctcgaaatattccccgactgccaagtcgccatcagcgccgaatgcggc cagtggtaa

DBGET integrated database retrieval system