Poecilia latipinna (sailfin molly): 106948681 Help Entry 106948681         CDS       T08005                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism plai  Poecilia latipinna (sailfin molly) Pathway plai03030   DNA replication plai03410   Base excision repair plai03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:plai00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     106948681 (pole4)    03410 Base excision repair     106948681 (pole4)    03420 Nucleotide excision repair     106948681 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:plai03032]     106948681 (pole4)    03400 DNA repair and recombination proteins [BR:plai03400]     106948681 (pole4) Enzymes [BR:plai01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      106948681 (pole4) DNA replication proteins [BR:plai03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     106948681 (pole4) DNA repair and recombination proteins [BR:plai03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       106948681 (pole4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  106948681 NCBI-ProteinID:  XP_014889987 Ensembl:  ENSPLAG00000023461 UniProt:  A0A3B3UZ58 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MAATVEAPVPAEQDSARCGTEEENRGAEVEEKSQQQQQQQQTCSTGPAVPHSRLSKLPLA RIKALMKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIE AIDEFAFLEGTLD NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggcagctactgtagaagcgcctgtcccagcggagcaggactctgcgcggtgcgggact gaagaggagaaccgcggggcggaggtggaggagaagagccagcagcagcagcagcagcag cagacatgctccaccgggcccgccgttcctcacagccgtctgtccaaactccctctggcc cgcatcaaagctctgatgaagaccgacccagacgtgtccctcgccagccaagagtccgtg ttcatcatcgctaaagccacggaattgtttgttgagatgattgccaaagacgctcttgtg tacgcccagcaaggaaagaggaaaacattacaaagaaaagacttggacaatgctattgag gccatagatgagtttgctttcctagaaggtacgctagattaa

DBGET integrated database retrieval system