Panthera leo (lion): 122199286 Help Entry 122199286         CDS       T10741                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism plez  Panthera leo (lion) Pathway plez01523   Antifolate resistance plez04010   MAPK signaling pathway plez04014   Ras signaling pathway plez04024   cAMP signaling pathway plez04062   Chemokine signaling pathway plez04064   NF-kappa B signaling pathway plez04066   HIF-1 signaling pathway plez04071   Sphingolipid signaling pathway plez04137   Mitophagy - animal plez04151   PI3K-Akt signaling pathway plez04210   Apoptosis plez04211   Longevity regulating pathway plez04218   Cellular senescence plez04380   Osteoclast differentiation plez04613   Neutrophil extracellular trap formation plez04620   Toll-like receptor signaling pathway plez04621   NOD-like receptor signaling pathway plez04622   RIG-I-like receptor signaling pathway plez04623   Cytosolic DNA-sensing pathway plez04625   C-type lectin receptor signaling pathway plez04657   IL-17 signaling pathway plez04658   Th1 and Th2 cell differentiation plez04659   Th17 cell differentiation plez04660   T cell receptor signaling pathway plez04662   B cell receptor signaling pathway plez04668   TNF signaling pathway plez04722   Neurotrophin signaling pathway plez04917   Prolactin signaling pathway plez04920   Adipocytokine signaling pathway plez04926   Relaxin signaling pathway plez04931   Insulin resistance plez04932   Non-alcoholic fatty liver disease plez04933   AGE-RAGE signaling pathway in diabetic complications plez04936   Alcoholic liver disease plez05010   Alzheimer disease plez05022   Pathways of neurodegeneration - multiple diseases plez05030   Cocaine addiction plez05132   Salmonella infection plez05133   Pertussis plez05134   Legionellosis plez05135   Yersinia infection plez05140   Leishmaniasis plez05142   Chagas disease plez05145   Toxoplasmosis plez05146   Amoebiasis plez05152   Tuberculosis plez05160   Hepatitis C plez05161   Hepatitis B plez05162   Measles plez05163   Human cytomegalovirus infection plez05164   Influenza A plez05165   Human papillomavirus infection plez05166   Human T-cell leukemia virus 1 infection plez05167   Kaposi sarcoma-associated herpesvirus infection plez05168   Herpes simplex virus 1 infection plez05169   Epstein-Barr virus infection plez05170   Human immunodeficiency virus 1 infection plez05171   Coronavirus disease - COVID-19 plez05200   Pathways in cancer plez05202   Transcriptional misregulation in cancer plez05203   Viral carcinogenesis plez05207   Chemical carcinogenesis - receptor activation plez05208   Chemical carcinogenesis - reactive oxygen species plez05212   Pancreatic cancer plez05215   Prostate cancer plez05220   Chronic myeloid leukemia plez05221   Acute myeloid leukemia plez05222   Small cell lung cancer plez05235   PD-L1 expression and PD-1 checkpoint pathway in cancer plez05321   Inflammatory bowel disease plez05415   Diabetic cardiomyopathy plez05417   Lipid and atherosclerosis plez05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122199286 (RELA)    04014 Ras signaling pathway     122199286 (RELA)    04064 NF-kappa B signaling pathway     122199286 (RELA)    04668 TNF signaling pathway     122199286 (RELA)    04066 HIF-1 signaling pathway     122199286 (RELA)    04071 Sphingolipid signaling pathway     122199286 (RELA)    04024 cAMP signaling pathway     122199286 (RELA)    04151 PI3K-Akt signaling pathway     122199286 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     122199286 (RELA)   09143 Cell growth and death    04210 Apoptosis     122199286 (RELA)    04218 Cellular senescence     122199286 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122199286 (RELA)    04620 Toll-like receptor signaling pathway     122199286 (RELA)    04621 NOD-like receptor signaling pathway     122199286 (RELA)    04622 RIG-I-like receptor signaling pathway     122199286 (RELA)    04623 Cytosolic DNA-sensing pathway     122199286 (RELA)    04625 C-type lectin receptor signaling pathway     122199286 (RELA)    04660 T cell receptor signaling pathway     122199286 (RELA)    04658 Th1 and Th2 cell differentiation     122199286 (RELA)    04659 Th17 cell differentiation     122199286 (RELA)    04657 IL-17 signaling pathway     122199286 (RELA)    04662 B cell receptor signaling pathway     122199286 (RELA)    04062 Chemokine signaling pathway     122199286 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     122199286 (RELA)    04917 Prolactin signaling pathway     122199286 (RELA)    04926 Relaxin signaling pathway     122199286 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     122199286 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     122199286 (RELA)   09149 Aging    04211 Longevity regulating pathway     122199286 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122199286 (RELA)    05202 Transcriptional misregulation in cancer     122199286 (RELA)    05207 Chemical carcinogenesis - receptor activation     122199286 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     122199286 (RELA)    05203 Viral carcinogenesis     122199286 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122199286 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     122199286 (RELA)    05221 Acute myeloid leukemia     122199286 (RELA)    05220 Chronic myeloid leukemia     122199286 (RELA)    05215 Prostate cancer     122199286 (RELA)    05222 Small cell lung cancer     122199286 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122199286 (RELA)    05170 Human immunodeficiency virus 1 infection     122199286 (RELA)    05161 Hepatitis B     122199286 (RELA)    05160 Hepatitis C     122199286 (RELA)    05171 Coronavirus disease - COVID-19     122199286 (RELA)    05164 Influenza A     122199286 (RELA)    05162 Measles     122199286 (RELA)    05168 Herpes simplex virus 1 infection     122199286 (RELA)    05163 Human cytomegalovirus infection     122199286 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     122199286 (RELA)    05169 Epstein-Barr virus infection     122199286 (RELA)    05165 Human papillomavirus infection     122199286 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     122199286 (RELA)    05135 Yersinia infection     122199286 (RELA)    05133 Pertussis     122199286 (RELA)    05134 Legionellosis     122199286 (RELA)    05152 Tuberculosis     122199286 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     122199286 (RELA)    05145 Toxoplasmosis     122199286 (RELA)    05140 Leishmaniasis     122199286 (RELA)    05142 Chagas disease     122199286 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     122199286 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     122199286 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     122199286 (RELA)   09165 Substance dependence    05030 Cocaine addiction     122199286 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122199286 (RELA)    05418 Fluid shear stress and atherosclerosis     122199286 (RELA)    05415 Diabetic cardiomyopathy     122199286 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122199286 (RELA)    04932 Non-alcoholic fatty liver disease     122199286 (RELA)    04931 Insulin resistance     122199286 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     122199286 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     122199286 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:plez03000]     122199286 (RELA) Transcription factors [BR:plez03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     122199286 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  122199286 NCBI-ProteinID:  XP_042760134 UniProt:  A0A8C8WTZ8 LinkDB All DBs Position D1:complement(108537897..108546450) Genome browser AA seq 553 aa AA seqDB search MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF EEFSPMVFSSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPAPAPAPAPAPILAPGLAQ AVVPPAPKTTQAGEGTLTEALLQLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQLL NQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIA DMDFSALLSQISS NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt cgctccgcgggcagtatccccggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacaccgggccagggacagttcgcatctcattggtcaccaaggac ccccctcatcggcctcacccccatgagctggtgggaaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatccc ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctcg catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttct caagctgacgtacaccgacaagtggccattgtgttccggacacctccctatgccgacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaatttcagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcctccaccccggcgcatcgctgtgccttcccgaagctcagctgcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtcttctcttccgggcagatcccaagccagacccctgccttg gcaccagcccctgccccaatcctggccccggcccctgcctctgtcccggcccctgccccg gtccccgcccccgccccggccccggcccctgccccaatcttagccccaggccttgctcag gctgtggtcccgcctgctcccaagaccacccaggctggggaagggacgctgacggaggcc ctgctgcagctgcagtttgacgctgatgaagacctgggggccctgcttggcaacagcgcc gacccggcagtgttcacagacctggcatccgtcgacaactctgagtttcagcagctgctg aaccagggtgtatctgtggccccccacccagctgagcccatgctgatggaataccctgag gcaataactcgcctggtgacgggatcccagaggccccctgacccagctcccgctcccctg ggggcctcggggcttcccaacggcctcctctcaggggatgaagacttctcttccattgcc gacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system