Panthera leo (lion): 122219685 Help Entry 122219685         CDS       T10741                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism plez  Panthera leo (lion) Pathway plez01523   Antifolate resistance plez04010   MAPK signaling pathway plez04060   Cytokine-cytokine receptor interaction plez04061   Viral protein interaction with cytokine and cytokine receptor plez04064   NF-kappa B signaling pathway plez04071   Sphingolipid signaling pathway plez04150   mTOR signaling pathway plez04210   Apoptosis plez04217   Necroptosis plez04350   TGF-beta signaling pathway plez04380   Osteoclast differentiation plez04612   Antigen processing and presentation plez04620   Toll-like receptor signaling pathway plez04621   NOD-like receptor signaling pathway plez04622   RIG-I-like receptor signaling pathway plez04625   C-type lectin receptor signaling pathway plez04640   Hematopoietic cell lineage plez04650   Natural killer cell mediated cytotoxicity plez04657   IL-17 signaling pathway plez04660   T cell receptor signaling pathway plez04664   Fc epsilon RI signaling pathway plez04668   TNF signaling pathway plez04920   Adipocytokine signaling pathway plez04930   Type II diabetes mellitus plez04931   Insulin resistance plez04932   Non-alcoholic fatty liver disease plez04933   AGE-RAGE signaling pathway in diabetic complications plez04936   Alcoholic liver disease plez04940   Type I diabetes mellitus plez05010   Alzheimer disease plez05014   Amyotrophic lateral sclerosis plez05020   Prion disease plez05022   Pathways of neurodegeneration - multiple diseases plez05132   Salmonella infection plez05133   Pertussis plez05134   Legionellosis plez05135   Yersinia infection plez05140   Leishmaniasis plez05142   Chagas disease plez05143   African trypanosomiasis plez05144   Malaria plez05145   Toxoplasmosis plez05146   Amoebiasis plez05152   Tuberculosis plez05160   Hepatitis C plez05161   Hepatitis B plez05163   Human cytomegalovirus infection plez05164   Influenza A plez05165   Human papillomavirus infection plez05166   Human T-cell leukemia virus 1 infection plez05168   Herpes simplex virus 1 infection plez05169   Epstein-Barr virus infection plez05170   Human immunodeficiency virus 1 infection plez05171   Coronavirus disease - COVID-19 plez05205   Proteoglycans in cancer plez05310   Asthma plez05321   Inflammatory bowel disease plez05322   Systemic lupus erythematosus plez05323   Rheumatoid arthritis plez05330   Allograft rejection plez05332   Graft-versus-host disease plez05410   Hypertrophic cardiomyopathy plez05414   Dilated cardiomyopathy plez05417   Lipid and atherosclerosis plez05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122219685 (TNF)    04350 TGF-beta signaling pathway     122219685 (TNF)    04064 NF-kappa B signaling pathway     122219685 (TNF)    04668 TNF signaling pathway     122219685 (TNF)    04071 Sphingolipid signaling pathway     122219685 (TNF)    04150 mTOR signaling pathway     122219685 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122219685 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     122219685 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     122219685 (TNF)    04217 Necroptosis     122219685 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     122219685 (TNF)    04620 Toll-like receptor signaling pathway     122219685 (TNF)    04621 NOD-like receptor signaling pathway     122219685 (TNF)    04622 RIG-I-like receptor signaling pathway     122219685 (TNF)    04625 C-type lectin receptor signaling pathway     122219685 (TNF)    04650 Natural killer cell mediated cytotoxicity     122219685 (TNF)    04612 Antigen processing and presentation     122219685 (TNF)    04660 T cell receptor signaling pathway     122219685 (TNF)    04657 IL-17 signaling pathway     122219685 (TNF)    04664 Fc epsilon RI signaling pathway     122219685 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     122219685 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     122219685 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     122219685 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122219685 (TNF)    05170 Human immunodeficiency virus 1 infection     122219685 (TNF)    05161 Hepatitis B     122219685 (TNF)    05160 Hepatitis C     122219685 (TNF)    05171 Coronavirus disease - COVID-19     122219685 (TNF)    05164 Influenza A     122219685 (TNF)    05168 Herpes simplex virus 1 infection     122219685 (TNF)    05163 Human cytomegalovirus infection     122219685 (TNF)    05169 Epstein-Barr virus infection     122219685 (TNF)    05165 Human papillomavirus infection     122219685 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     122219685 (TNF)    05135 Yersinia infection     122219685 (TNF)    05133 Pertussis     122219685 (TNF)    05134 Legionellosis     122219685 (TNF)    05152 Tuberculosis     122219685 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     122219685 (TNF)    05144 Malaria     122219685 (TNF)    05145 Toxoplasmosis     122219685 (TNF)    05140 Leishmaniasis     122219685 (TNF)    05142 Chagas disease     122219685 (TNF)    05143 African trypanosomiasis     122219685 (TNF)   09163 Immune disease    05310 Asthma     122219685 (TNF)    05322 Systemic lupus erythematosus     122219685 (TNF)    05323 Rheumatoid arthritis     122219685 (TNF)    05321 Inflammatory bowel disease     122219685 (TNF)    05330 Allograft rejection     122219685 (TNF)    05332 Graft-versus-host disease     122219685 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     122219685 (TNF)    05014 Amyotrophic lateral sclerosis     122219685 (TNF)    05020 Prion disease     122219685 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     122219685 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122219685 (TNF)    05418 Fluid shear stress and atherosclerosis     122219685 (TNF)    05410 Hypertrophic cardiomyopathy     122219685 (TNF)    05414 Dilated cardiomyopathy     122219685 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     122219685 (TNF)    04940 Type I diabetes mellitus     122219685 (TNF)    04936 Alcoholic liver disease     122219685 (TNF)    04932 Non-alcoholic fatty liver disease     122219685 (TNF)    04931 Insulin resistance     122219685 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     122219685 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     122219685 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plez04052]     122219685 (TNF)    00536 Glycosaminoglycan binding proteins [BR:plez00536]     122219685 (TNF) Cytokines and neuropeptides [BR:plez04052]  Cytokines   Tumor necrosis fators    122219685 (TNF) Glycosaminoglycan binding proteins [BR:plez00536]  Heparan sulfate / Heparin   Cytokines    122219685 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  122219685 NCBI-ProteinID:  XP_042794163 UniProt:  A0A8C9D3I7 LinkDB All DBs Position B2:30282491..30285006 Genome browser AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFGVIGPQR EELPHGLQLINPLPQTLRSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELT DNQLKVPSDGLYLIYSQVLFTGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcactccccaagaag gcagggggcccccagggctccagaaggtgcttgtgcctcagcctcttctccttcctcctc gtcgcaggagccaccacactcttctgcctgctgcactttggagtgatcggcccccagagg gaagagctcccacatggcctgcaactaatcaaccctctgccccagacactcagatcatct tctcgaactccgagtgacaagccagtagcccatgtagtagcaaaccccgaagctgaaggg caactccagtggctgagccggcgtgccaatgccctcctggccaatggcgtggagctgaca gacaaccagctgaaggtgccctcagacgggctgtacctcatctactcccaggtcctcttc acgggccaaggatgtccttccacacatgtgctcctcacccacaccatcagccgctttgcc gtttcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggag accccagagggggctgaggccaagccctggtatgagcccatctacctgggaggggtcttc caactggagaagggtgatcgactcagcgctgagatcaatctgcctgactatcttgacttt gccgagtctgggcaagtctactttggaatcattgccctgtga

DBGET integrated database retrieval system