Panthera leo (lion): 122222954 Help Entry 122222954         CDS       T10741                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism plez  Panthera leo (lion) Pathway plez01522   Endocrine resistance plez04010   MAPK signaling pathway plez04024   cAMP signaling pathway plez04210   Apoptosis plez04380   Osteoclast differentiation plez04620   Toll-like receptor signaling pathway plez04657   IL-17 signaling pathway plez04658   Th1 and Th2 cell differentiation plez04659   Th17 cell differentiation plez04660   T cell receptor signaling pathway plez04662   B cell receptor signaling pathway plez04668   TNF signaling pathway plez04713   Circadian entrainment plez04725   Cholinergic synapse plez04728   Dopaminergic synapse plez04915   Estrogen signaling pathway plez04917   Prolactin signaling pathway plez04921   Oxytocin signaling pathway plez04926   Relaxin signaling pathway plez04928   Parathyroid hormone synthesis, secretion and action plez04932   Non-alcoholic fatty liver disease plez04935   Growth hormone synthesis, secretion and action plez05031   Amphetamine addiction plez05132   Salmonella infection plez05133   Pertussis plez05135   Yersinia infection plez05140   Leishmaniasis plez05142   Chagas disease plez05161   Hepatitis B plez05162   Measles plez05166   Human T-cell leukemia virus 1 infection plez05167   Kaposi sarcoma-associated herpesvirus infection plez05170   Human immunodeficiency virus 1 infection plez05171   Coronavirus disease - COVID-19 plez05200   Pathways in cancer plez05207   Chemical carcinogenesis - receptor activation plez05208   Chemical carcinogenesis - reactive oxygen species plez05210   Colorectal cancer plez05224   Breast cancer plez05231   Choline metabolism in cancer plez05235   PD-L1 expression and PD-1 checkpoint pathway in cancer plez05323   Rheumatoid arthritis plez05417   Lipid and atherosclerosis plez05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:plez00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122222954 (FOS)    04668 TNF signaling pathway     122222954 (FOS)    04024 cAMP signaling pathway     122222954 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     122222954 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122222954 (FOS)    04660 T cell receptor signaling pathway     122222954 (FOS)    04658 Th1 and Th2 cell differentiation     122222954 (FOS)    04659 Th17 cell differentiation     122222954 (FOS)    04657 IL-17 signaling pathway     122222954 (FOS)    04662 B cell receptor signaling pathway     122222954 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     122222954 (FOS)    04917 Prolactin signaling pathway     122222954 (FOS)    04921 Oxytocin signaling pathway     122222954 (FOS)    04926 Relaxin signaling pathway     122222954 (FOS)    04935 Growth hormone synthesis, secretion and action     122222954 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     122222954 (FOS)   09156 Nervous system    04725 Cholinergic synapse     122222954 (FOS)    04728 Dopaminergic synapse     122222954 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     122222954 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     122222954 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122222954 (FOS)    05207 Chemical carcinogenesis - receptor activation     122222954 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     122222954 (FOS)    05231 Choline metabolism in cancer     122222954 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122222954 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     122222954 (FOS)    05224 Breast cancer     122222954 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122222954 (FOS)    05170 Human immunodeficiency virus 1 infection     122222954 (FOS)    05161 Hepatitis B     122222954 (FOS)    05171 Coronavirus disease - COVID-19     122222954 (FOS)    05162 Measles     122222954 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     122222954 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     122222954 (FOS)    05135 Yersinia infection     122222954 (FOS)    05133 Pertussis     122222954 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     122222954 (FOS)    05142 Chagas disease     122222954 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     122222954 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     122222954 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122222954 (FOS)    05418 Fluid shear stress and atherosclerosis     122222954 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     122222954 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     122222954 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:plez03000]     122222954 (FOS)    04131 Membrane trafficking [BR:plez04131]     122222954 (FOS) Transcription factors [BR:plez03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     122222954 (FOS) Membrane trafficking [BR:plez04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     122222954 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  122222954 NCBI-ProteinID:  XP_042799765 UniProt:  A0A8C8WF71 LinkDB All DBs Position B3:119643646..119647055 Genome browser AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYSRAGVVKTVTAGGR AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL QTEIANLLKEKEKLEFILAAHRPACKIPDELGFPEEMSVASLDLSGGLPEAATPESEEAF TLPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFY AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCGAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcctgtcaatgcgcaggacttctgcacggatctggccgtctccagcgccaacttt atcccaacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggctccttctcagaccagagccccccacccctatggagtccccgcc ccctccgccggggcttactccagggctggagtcgtgaagaccgtgaccgcaggaggccga gctcagagcattggcaggaggggcaaagtggaacagttgtccccagaagaagaagagaaa aggagaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggcgg gagctcacggatacgctgcaagcggagacagaccaactagaagatgagaagtctgctttg cagactgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagct caccgacccgcctgcaagatccccgatgagctgggcttcccggaagagatgtctgtggct tccctagatctgagcgggggcctgccggaagctgccacccccgagtcggaggaggctttc accctgcccctcctcaatgatcctgagcccaagccctccgtggagccggtcaagagcatc agcagcatggagctgaaggccgagccctttgatgacttcctgttcccagcatcgtccagg cccagcggctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctat gcagcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagag ctggagcctctgtgcaccccggtggtcacctgtactcctagctgcactacttacacgtct tccttcgtcttcacctaccctgaggctgactccttccccagctgtggggctgctcaccgc aagggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggcc ctgtga

DBGET integrated database retrieval system