Panthera leo (lion): 122223669 Help Entry 122223669         CDS       T10741                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism plez  Panthera leo (lion) Pathway plez03050   Proteasome plez04060   Cytokine-cytokine receptor interaction plez04066   HIF-1 signaling pathway plez04217   Necroptosis plez04350   TGF-beta signaling pathway plez04380   Osteoclast differentiation plez04612   Antigen processing and presentation plez04630   JAK-STAT signaling pathway plez04650   Natural killer cell mediated cytotoxicity plez04657   IL-17 signaling pathway plez04658   Th1 and Th2 cell differentiation plez04659   Th17 cell differentiation plez04660   T cell receptor signaling pathway plez04940   Type I diabetes mellitus plez05140   Leishmaniasis plez05142   Chagas disease plez05143   African trypanosomiasis plez05144   Malaria plez05145   Toxoplasmosis plez05146   Amoebiasis plez05152   Tuberculosis plez05160   Hepatitis C plez05164   Influenza A plez05168   Herpes simplex virus 1 infection plez05200   Pathways in cancer plez05235   PD-L1 expression and PD-1 checkpoint pathway in cancer plez05321   Inflammatory bowel disease plez05322   Systemic lupus erythematosus plez05323   Rheumatoid arthritis plez05330   Allograft rejection plez05332   Graft-versus-host disease plez05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:plez00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     122223669 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     122223669 (IFNG)    04630 JAK-STAT signaling pathway     122223669 (IFNG)    04066 HIF-1 signaling pathway     122223669 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122223669 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122223669 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     122223669 (IFNG)    04612 Antigen processing and presentation     122223669 (IFNG)    04660 T cell receptor signaling pathway     122223669 (IFNG)    04658 Th1 and Th2 cell differentiation     122223669 (IFNG)    04659 Th17 cell differentiation     122223669 (IFNG)    04657 IL-17 signaling pathway     122223669 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     122223669 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122223669 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122223669 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     122223669 (IFNG)    05164 Influenza A     122223669 (IFNG)    05168 Herpes simplex virus 1 infection     122223669 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     122223669 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     122223669 (IFNG)    05144 Malaria     122223669 (IFNG)    05145 Toxoplasmosis     122223669 (IFNG)    05140 Leishmaniasis     122223669 (IFNG)    05142 Chagas disease     122223669 (IFNG)    05143 African trypanosomiasis     122223669 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     122223669 (IFNG)    05323 Rheumatoid arthritis     122223669 (IFNG)    05321 Inflammatory bowel disease     122223669 (IFNG)    05330 Allograft rejection     122223669 (IFNG)    05332 Graft-versus-host disease     122223669 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     122223669 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     122223669 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:plez03051]     122223669 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:plez04052]     122223669 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:plez00536]     122223669 (IFNG) Proteasome [BR:plez03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     122223669 (IFNG) Cytokines and neuropeptides [BR:plez04052]  Cytokines   Interferons    122223669 (IFNG) Glycosaminoglycan binding proteins [BR:plez00536]  Heparan sulfate / Heparin   Cytokines    122223669 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma COG6_C MSP1_C Motif Other DBs NCBI-GeneID:  122223669 NCBI-ProteinID:  XP_042800571 UniProt:  D1GA50 LinkDB All DBs Position B4:complement(92683966..92688354) Genome browser AA seq 167 aa AA seqDB search MNYTSFIFAFQLCIILCSSGCYCQAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWK EESDKTIIQSQIVSFYLKMFENLKDDDQRIQRNMDTIKEDMLDKLLNTSSSKRDDFLKLI QIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgaattacacaagttttattttcgcttttcagctttgcataattttgtgttcttctggt tgttactgtcaggccatgttttttaaagaaatagaagagctaaagggatattttaatgca agtaatccagatgtagcagatggtgggtcgcttttcgtagacattttgaagaactggaaa gaggagagtgataaaacaataattcaaagccaaattgtctccttctacttgaaaatgttt gaaaacctgaaagatgatgaccagcgcattcaaaggaacatggacaccatcaaggaagac atgcttgataagttgttaaataccagctccagtaaacgggatgacttcctcaagctgatt caaatccctgtgaatgatctgcaggtccagcgcaaagcaataaatgaactcttcaaagtg atgaacgatctctcaccaagatctaacctgaggaagcggaaaaggagtcagaatctgttt cgaggccgtagagcatcgaaataa

DBGET integrated database retrieval system